AGI ID: At5g66980

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g66980
MVDLSKDLQF FKVFLPEFGS HELVIPPAFI DMLEKPLPKE AFLVDEIGRL WCVETKTEDT
EERFCVFFTK GWQSFANDQS LEFGDFLVFS YDGDSRFSVT IFANDGCKKD VGVVSTTDRS
RVSLDEEEPD DIFTKPDRMR DCDCGQSINR KRKRDSVNED PHVLVDDKPE YVSTYKTKPE
HSEKTQRTVN RAGDTCDISW FPEKKHNGFE ESVYKPKHPH FVRNITRGSL QKLELPLTFL
RSNGIELEED IELCDESGKK WPLKILNHDR GFKFSHESWL CFCKSHEMIL TNKCLFEFIV
PSNGRCSEIL VRIVSGRLPT TMTKNNYQVI DMQP
Length = 334 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g66980

>At5g66980 putative protein
          Length = 334

 Score = 78.0 bits (191), Expect = 2e-14
 Identities = 16/102 (15%), Positives = 30/102 (28%), Gaps = 8/102 (7%)

Query: 571 LQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNK 630
             KV       +   +V+P    +     L        A       R+W +  +     +
Sbjct: 10  FFKVFLPEFGSHE--LVIPPAFIDMLEKPL-----PKEAFLVDEIGRLWCVETKTEDTEE 62

Query: 631 SR-MYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQP 671
              ++  +    F     L+ GDF+V   D      V +   
Sbjct: 63  RFCVFFTKGWQSFANDQSLEFGDFLVFSYDGDSRFSVTIFAN 104


InterPro Results:

IPR003340 Family
PF02362 T[9-107] 3.4e-09T[220-319] 1.2e-20 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[62-152] 4.5e-09 Cupredoxins
Cupredoxin
NULL
seg ?[245-256] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 78 2e-14
TF_17_2 ARFNPH4/ARF7 48 4e-05

TOP