AGI ID: At5g65510

TF ID:TF_2_2
Super family:AP2/EREBP
Sub family:AINTEGUMENTA
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At5g65510
MADSTTLSTF FDHSQTQIPK LEDFLGDSFV RYSDNQTETQ DSSSLTPFYD PRHRTVAEGV
TGFFSDHHQP DFKTINSGPE IFDDSTTSNI GGTHLSSHVV ESSTTAKLGF NGDCTTTGGV
LSLGVNNTSD QPLSCNNGER GGNSNKKKTV SKKETSDDSK KKIVETLGQR TSIYRGVTRH
RWTGRYEAHL WDNSCRREGQ ARKGRQGGYD KEDRAARAYD LAALKYWGST ATTNFPVSSY
SKELEEMNHM TKQEFIASLR RKSSGFSRGA SIYRGVTRHH QQGRWQARIG RVAGNKDLYL
GTFATEEEAA EAYDIAAIKF RGINAVTNFE MNRYDIEAVM NSSLPVGGAA AKRHKLKLAL
ESPSSSSSDH NLQQQQLLPS SSPSDQNPNS IPCGIPFEPS VLYYHQNFFQ HYPLVSDSTI
QAPMNQAEFF LWPNQSY
Length = 437 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_2
Sbjct: At5g65510

>At5g65510 putative protein
          Length = 437

 Score =  367 bits (943), Expect = e-102
 Identities = 176/430 (40%), Positives = 234/430 (53%), Gaps = 38/430 (8%)

Query: 96  LMEALNRSSHSNHHQDSSPKVEDFFGTH--HNNTSHKEAMDLSLDSLFYNTTHEPNTTTN 153
           + ++   S+  +H Q   PK+EDF G      + +  E  D S  + FY+  H       
Sbjct: 1   MADSTTLSTFFDHSQTQIPKLEDFLGDSFVRYSDNQTETQDSSSLTPFYDPRHR-TVAEG 59

Query: 154 FQEFFSFPQTRNHEEETRNYGNDPSL-THGGSFNVG--VYGEFXXXXXXXXXXXXXXXCI 210
              FFS     +H+ + +   + P +     + N+G                      C 
Sbjct: 60  VTGFFS----DHHQPDFKTINSGPEIFDDSTTSNIGGTHLSSHVVESSTTAKLGFNGDCT 115

Query: 211 TGXXXXXXXXXXXXXXXXXXXISEALVETSVGFETTTMAAAKKKRGQEDVVVVGQKQIVH 270
           T                    ++    +            + KK   + V          
Sbjct: 116 TT------------GGVLSLGVNNTSDQPLSCNNGERGGNSNKK---KTVSKKETSDDSK 160

Query: 271 RKSIDTFGQRTSQYRGVTRHRWTGRYEAHLWDNSFKKEGHSRKGRQVYLGGYDMEEKAAR 330
           +K ++T GQRTS YRGVTRHRWTGRYEAHLWDNS ++EG +RKGRQ   GGYD E++AAR
Sbjct: 161 KKIVETLGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQARKGRQ---GGYDKEDRAAR 217

Query: 331 AYDLAALKYWGPSTHTNFSAENYQKEIEDMKNMTRQEYVAHLRRKSSGFSRGASIYRGVT 390
           AYDLAALKYWG +  TNF   +Y KE+E+M +MT+QE++A LRRKSSGFSRGASIYRGVT
Sbjct: 218 AYDLAALKYWGSTATTNFPVSSYSKELEEMNHMTKQEFIASLRRKSSGFSRGASIYRGVT 277

Query: 391 RHHQHGRWQARIGRVAGNKDLYLGTFGTQEEAAEAYDVAAIKFRGTNAVTNFDITRYDVD 450
           RHHQ GRWQARIGRVAGNKDLYLGTF T+EEAAEAYD+AAIKFRG NAVTNF++ RYD++
Sbjct: 278 RHHQQGRWQARIGRVAGNKDLYLGTFATEEEAAEAYDIAAIKFRGINAVTNFEMNRYDIE 337

Query: 451 RIMSSNTLLSGELARRNNNSIVVR---------NTEDQTALNAVVEGGSNKEVSTPERLL 501
            +M+S+  + G  A+R+   + +          N + Q  L +      N   S P  + 
Sbjct: 338 AVMNSSLPVGGAAAKRHKLKLALESPSSSSSDHNLQQQQLLPSSSPSDQNPN-SIPCGIP 396

Query: 502 SFPAIFALPQ 511
             P++    Q
Sbjct: 397 FEPSVLYYHQ 406


InterPro Results:

IPR001471 Domain
PD001423 T[283-323] 2e-07 sp_Q9SYC2_ARATH_Q9SYC2;
PR00367 T[174-185] 3.2e-07T[312-332] 3.2e-07 ETHRSPELEMNT
PF00847 T[172-241] 4.1e-29T[271-335] 2.2e-32 AP2
SM00380 T[173-242] 1.2e-21T[272-336] 6.3e-30 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[143-162]?[213-226]?[304-317]?[349-390] seg
SSF54171 T[172-238] 9.9e-17T[271-332] 6.8e-20 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_2 AP2/EREBPAINTEGUMENTA367 e-102
TF_2_3 AP2/EREBPAPETALA2214 7e-56
TF_2_4 AP2/EREBPCBF1 93 9e-20
TF_67 Pti6 93 2e-19
TF_68 ERF 89 1e-18
TF_66 Pti5 89 1e-18
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 79 3e-15

TOP