AGI ID: At5g62000

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: auxin response factor - like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g62000
MASSEVSMKG NRGGDNFSSS GFSDPKETRN VSVAGEGQKS NSTRSAAAER ALDPEAALYR
ELWHACAGPL VTVPRQDDRV FYFPQGHIEQ ASTNQAAEQQ MPLYDLPSKL LCRVINVDLK
AEADTDEVYA QITLLPEANQ DENAIEKEAP LPPPPRFQVH SFCKTLTASD TSTHGGFSVL
RRHADECLPP LDMSRQPPTQ ELVAKDLHAN EWRFRHIFRG QPRRHLLQSG WSVFVSSKRL
VAGDAFIFLR GENGELRVGV RRAMRQQGNV PSSVISSHSM HLGVLATAWH AISTGTMFTV
YYKPRTSPSE FIVPFDQYME SVKNNYSIGM RFKMRFEGEE APEQRFTGTI VGIEESDPTR
WPKSKWRSLK V
Length = 371 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At5g62000

>At5g62000 auxin response factor - like protein
          Length = 371

 Score =  481 bits (1238), Expect = e-136
 Identities = 163/321 (50%), Positives = 216/321 (66%), Gaps = 14/321 (4%)

Query: 53  LELWHACAGPLISLPKRGSLVLYFPQGHLE-----QAPDFSAAIYGLPPHVFCRILDVKL 107
            ELWHACAGPL+++P++   V YFPQGH+E     QA +    +Y LP  + CR+++V L
Sbjct: 60  RELWHACAGPLVTVPRQDDRVFYFPQGHIEQASTNQAAEQQMPLYDLPSKLLCRVINVDL 119

Query: 108 HAETTTDEVYAQVSLLPESEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASD 167
            AE  TDEVYAQ++LLPE+   E  + +        E       R    H FCKTLTASD
Sbjct: 120 KAEADTDEVYAQITLLPEANQDENAIEK--------EAPLPPPPRF-QVHSFCKTLTASD 170

Query: 168 TSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTG 227
           TSTHGGFSV RR A++C PPLD S+  P+QEL+A+DLH  EWRFRHI+RGQPRRHLL +G
Sbjct: 171 TSTHGGFSVLRRHADECLPPLDMSRQPPTQELVAKDLHANEWRFRHIFRGQPRRHLLQSG 230

Query: 228 WSAFVNKKKLVSGDAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSEVAH 287
           WS FV+ K+LV+GDA +FLRG++G+LR+GVRRA + +G    S   + +M+    +   H
Sbjct: 231 WSVFVSSKRLVAGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWH 290

Query: 288 AISTHSVFSISYNPKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSPGII 347
           AIST ++F++ Y P+ S S FI+P  ++++ V   + IGMRFK R E E+A E+R  G I
Sbjct: 291 AISTGTMFTVYYKPRTSPSEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTI 350

Query: 348 SGISDLDPIRWPGSKWRCLLV 368
            GI + DP RWP SKWR L V
Sbjct: 351 VGIEESDPTRWPKSKWRSLKV 371


InterPro Results:

IPR003340 Family
PF02362 T[161-266] 4.1e-12 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[288-370] 2.5e-59 Auxin_resp
Auxin response factor
NULL
seg ?[10-24]?[46-58] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3481 e-136
TF_17_1 ARFMONOPTEROS/ARF5475 e-134
TF_17_2 ARFNPH4/ARF7433 e-121
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3153 2e-37
TF_22_1 ABI3/VP1FUSCA3113 1e-25

TOP