AGI ID: At5g60450

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: auxin response factor 4

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
>At5g60450
MEFDLNTEIA EVEEEENDDV GVGVGGGTRI DKGRLGISPS SSSSCSSGSS SSSSSTGSAS
SIYSELWHAC AGPLTCLPKK GNVVVYFPQG HLEQDAMVSY SSPLEIPKFD LNPQIVCRVV
NVQLLANKDT DEVYTQVTLL PLQEFSMLNG EGKEVKELGG EEERNGSSSV KRTPHMFCKT
LTASDTSTHG GFSVPRRAAE DCFAPLDYKQ QRPSQELIAK DLHGVEWKFR HIYRGQPRRH
LLTTGWSIFV SQKNLVSGDA VLFLRDEGGE LRLGIRRAAR PRNGLPDSII EKNSCSNILS
LVANAVSTKS MFHVFYSPRA THAEFVIPYE KYITSIRSPV CIGTRFRMRF EMDDSPERRC
AGVVTGVCDL DPYRWPNSKW RCLLVRWDES FVSDHQERVS PWEIDPSVSL PHLSIQSSPR
PKRPWAGLLD TTPPGNPITK RGGFLDFEES VRPSKVLQGQ ENIGSASPSQ GFDVMNRRIL
DFAMQSHANP VLVSSRVKDR FGEFVDATGV NPACSGVMDL DRFPRVLQGQ EICSLKSFPQ
FAGFSPAAAP NPFAYQANKS SYYPLALHGI RSTHVPYQNP YNAGNQSSGP PSRAINFGEE
TRKFDAQNEG GLPNNVTADL PFKIDMMGKQ KGSELNMNAS SGCKLFGFSL PVETPASKPQ
SSSKRICTKV HKQGSQVGRA IDLSRLNGYD DLLMELERLF NMEGLLRDPE KGWRILYTDS
ENDMMVVGDD PWHDFCNVVW KIHLYTKEEV ENANDDNKSC LEQAALMMEA SKSSSVSQPD
SSPTITRV
Length = 788 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At5g60450

>At5g60450 auxin response factor 4
          Length = 788

 Score =  555 bits (1430), Expect = e-158
 Identities = 215/400 (53%), Positives = 274/400 (67%), Gaps = 13/400 (3%)

Query: 54  ELWHACAGPLISLPKRGSLVLYFPQGHLEQAP------DFSAAIYGLPPHVFCRILDVKL 107
           ELWHACAGPL  LPK+G++V+YFPQGHLEQ              + L P + CR+++V+L
Sbjct: 65  ELWHACAGPLTCLPKKGNVVVYFPQGHLEQDAMVSYSSPLEIPKFDLNPQIVCRVVNVQL 124

Query: 108 HAETTTDEVYAQVSLLPESEDIERKVREGIIDVDGGE---EDYEVLKRSNTPHMFCKTLT 164
            A   TDEVY QV+LLP  E          +   GGE        +KR+   HMFCKTLT
Sbjct: 125 LANKDTDEVYTQVTLLPLQEFSMLNGEGKEVKELGGEEERNGSSSVKRTP--HMFCKTLT 182

Query: 165 ASDTSTHGGFSVPRRAAEDCFPPLDYSQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLL 224
           ASDTSTHGGFSVPRRAAEDCF PLDY Q RPSQEL+A+DLHG+EW+FRHIYRGQPRRHLL
Sbjct: 183 ASDTSTHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLL 242

Query: 225 TTGWSAFVNKKKLVSGDAVLFLRGDDGKLRLGVRRASQIEGTAALSAQYNQNMNHNNFSE 284
           TTGWS FV++K LVSGDAVLFLR + G+LRLG+RRA++       S    +N   N  S 
Sbjct: 243 TTGWSIFVSQKNLVSGDAVLFLRDEGGELRLGIRRAARPRNGLPDSII-EKNSCSNILSL 301

Query: 285 VAHAISTHSVFSISYNPKASWSNFIIPAPKFLKVVDYPFCIGMRFKARVESEDASERRSP 344
           VA+A+ST S+F + Y+P+A+ + F+IP  K++  +  P CIG RF+ R E +D+ ERR  
Sbjct: 302 VANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRSPVCIGTRFRMRFEMDDSPERRCA 361

Query: 345 GIISGISDLDPIRWPGSKWRCLLVRWDDIVANGHQQRVSPWEIEPSGSISNSGSFVTTGP 404
           G+++G+ DLDP RWP SKWRCLLVRWD+   + HQ+RVSPWEI+PS S+ +     +  P
Sbjct: 362 GVVTGVCDLDPYRWPNSKWRCLLVRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRP 421

Query: 405 KRSRIG-ISSGKPDIPVSEGIRATDFEESLRFQRVLQGQE 443
           KR   G + +  P  P+++     DFEES+R  +VLQGQE
Sbjct: 422 KRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQE 461


InterPro Results:

IPR003340 Family
PF02362 T[176-281] 1.2e-14 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[302-384] 1.4e-58 Auxin_resp
Auxin response factor
NULL
seg ?[11-27]?[38-64]?[150-163]?[771-782] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3555 e-158
TF_17_2 ARFNPH4/ARF7482 e-136
TF_17_1 ARFMONOPTEROS/ARF5480 e-135
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3138 8e-33
TF_22_1 ABI3/VP1FUSCA3116 2e-26
TF_55 Aux/IAA115 2e-26

TOP