AGI ID: At5g60140

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g60140
MNTRGNYSNG FTSKFFKPYL PSESGDDLVL PISFNSCLPK SLPKTVTVRS ISGNIWKLGF
KKCGGEVERF VMVSGWKKIV RDENLNGGDL LSFEFDGSHF FNFSIFDHET TCKRLKRSSE
QSKDIIKVGS DCEEESQASD DVIVLNSDDS DDSDNDYSVE DDNVAEDDDG LEDEVDVEAE
DGYDAKDSDG LEDEDDDEAE DGYDAKDDDG LEDEDDLEDE DDERRYLDDH ENPYFTMTLN
PKKKSQLHIP AHVIRDYDLT FPERITVVDE MGALEKAIKI QKNGCIFVKG FGSFIRRNKM
KMTDKMICEL KRTGGNLVHT IKVKIISG
Length = 328 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g60140

>At5g60140 putative protein
          Length = 328

 Score = 80.7 bits (198), Expect = 3e-15
 Identities = 19/131 (14%), Positives = 37/131 (27%), Gaps = 8/131 (6%)

Query: 556 DRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGT 615
              +G           +  L  S+ G+   +VLP     + LP+               +
Sbjct: 1   MNTRGNYSNGFTSKFFKPYL-PSESGDD--LVLPISF-NSCLPK----SLPKTVTVRSIS 52

Query: 616 SRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQK 675
             +W + ++       R  ++      V+   L  GD +    D        +       
Sbjct: 53  GNIWKLGFKKCGGEVERFVMVSGWKKIVRDENLNGGDLLSFEFDGSHFFNFSIFDHETTC 112

Query: 676 PEAPPSSAATK 686
                SS  +K
Sbjct: 113 KRLKRSSEQSK 123


InterPro Results:

NULL
seg ?[139-229] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 81 3e-15

TOP