AGI ID: At5g60130

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At5g60130
MVLPISFTRF LPKSLPETVT VRSISGNIWK LELKKCCGDD DTEKFVMVNG WKRIVKDEDL
KGGDFLEFEF DGSSCFHFCI YEHRTMCKKI RRSSDQSEEI KVESDSDEQN QASDDVLSLD
EDDDDSDYNC GEDNDSDDYA DEAAVEKDDN DADDEDVDNV ADDVPVEDDD YVEAFDSRDH
AKADDDDEDE RQYLDDRENP SFTLILNPKK KSQLLIPARV IKDYDLHFPE SITLVDPLVK
KFGTLEKQIK IQTNGSVFVK GFGSIIRRNK VKTTDKMIFE IKKTGDNNLV QTIKIHIISG
Length = 300 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g60130

>At5g60130 putative protein
          Length = 300

 Score = 83.8 bits (206), Expect = 3e-16
 Identities = 19/116 (16%), Positives = 36/116 (30%), Gaps = 18/116 (15%)

Query: 586 IVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFW--PNNKSRMYLLENTGDFV 643
           +VLP       LP+               +  +W +  +     ++  +  ++      V
Sbjct: 1   MVLPISF-TRFLPK----SLPETVTVRSISGNIWKLELKKCCGDDDTEKFVMVNGWKRIV 55

Query: 644 KTNGLQEGDFIVIYSDVKLIRGVK----------VRQPSGQKPEAP-PSSAATKRQ 688
           K   L+ GDF+    D                  +R+ S Q  E    S +  + Q
Sbjct: 56  KDEDLKGGDFLEFEFDGSSCFHFCIYEHRTMCKKIRRSSDQSEEIKVESDSDEQNQ 111


InterPro Results:

NULL
seg ?[114-135]?[140-174]?[176-198] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 84 3e-16
TF_17_2 ARFNPH4/ARF7 45 3e-04

TOP