AGI ID: At5g59570

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: ARR1 protein - like

Amino Acid Sequence:


1
61
121
181
241
>At5g59570
MGKEVMVSDY GDDDGEDAGG GDEYRIPEWE IGLPNGDDLT PLSQYLVPSI LALAFSMIPE
RSRTIHDVNR ASQITLSSLR SSTNASSVME EVVDRVESSV PGSDPKKQKK SDGGEAAAVE
DSTAEEGDSG PEDASGKTSK RPRLVWTPQL HKRFVDVVAH LGIKNAVPKT IMQLMNVEGL
TRENVASHLQ KYRLYLKRIQ GLTTEEDPYS SSDQLFSSTP VPPQSFQDGG GSNGKLGVPV
PVPSMVPIPG YGNQMGMQGY YQQYSNHGNE SNQYMMQQNK FGTMVTYPSV GGGDVNDK
Length = 298 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At5g59570

>At5g59570 ARR1 protein - like
          Length = 298

 Score =  111 bits (279), Expect = 5e-26
 Identities = 39/63 (61%), Positives = 54/63 (84%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           +PR+VW+ +LH++FV  V  LG++ AVPK I++LMNV GLTRENVASHLQKYR+YL+R+ 
Sbjct: 141 RPRLVWTPQLHKRFVDVVAHLGIKNAVPKTIMQLMNVEGLTRENVASHLQKYRLYLKRIQ 200

Query: 61  GVS 63
           G++
Sbjct: 201 GLT 203


InterPro Results:

IPR001005 Domain
PF00249 T[143-193] 2e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[141-196] 8e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[137-200] 4.7e-20 Homeodomain-like
Homeodomain-like
NULL
seg ?[9-24]?[75-87]?[238-249]?[250-264] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class111 5e-26
TF_10_1 GARPG2-like112 1e-24
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 82 9e-16
TF_1_2 MYB superfamilyLHY 72 8e-13

TOP