AGI ID: At5g58280

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g58280
MAMAYEEARK LRLQENHKRF QSNFVALPQF QLLQQRNHKP IDKALLATAE PRRSSRVRTV
ISSYRDDVVV DTGRTSNLRR SRHSSTWATY ISRPLHECKF ASYEEKVGAF KAAEKFQRSL
KSPHPYFVKS MVRSHVYSCF WLGLPSRFCA DNFPEETMEI ELEDEEGEVY EAVYIGRRAG
LSGGWKRFAL DHKLDDGDAL LFELVEPKKF KIYVFKGNEN ANLTSARKRG RATTPSEEEE
EEEDKDVEES GDEEHSSRAT KRSSVRLLRK RKA
Length = 273 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g58280

>At5g58280 unknown protein
          Length = 273

 Score = 73.0 bits (178), Expect = 6e-13
 Identities = 19/127 (14%), Positives = 39/127 (29%), Gaps = 13/127 (10%)

Query: 561 WKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWN 620
            +  K+      K + +S V +   + LP +    + P     +       +     V+ 
Sbjct: 117 QRSLKSPHPYFVKSMVRSHVYSCFWLGLPSRFCADNFP-----EETMEIELEDEEGEVYE 171

Query: 621 MRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEAPP 680
             Y        R  L      F   + L +GD ++          + V + +     A  
Sbjct: 172 AVYI-----GRRAGLSGGWKRFALDHKLDDGDALLFELVEPKKFKIYVFKGN---ENANL 223

Query: 681 SSAATKR 687
           +SA  + 
Sbjct: 224 TSARKRG 230


InterPro Results:

IPR003340 Family
PF02362 T[126-220] 7.4e-29 B3
Transcriptional factor B3
NULL
seg ?[52-65]?[155-171]?[237-254]?[261-272] seg
SSF54236 T[153-229] 4.3e-12 Ubiquitin-like
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 73 6e-13
TF_22_1 ABI3/VP1FUSCA3 44 8e-05

TOP