AGI ID: At5g58080

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: ARR2 - like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At5g58080
MEFGSTEDGR HDKFPVGMRV LAVDDNPTCL RKLEELLLRC KYHVTKTMES RKALEMLREN
SNMFDLVISD VEMPDTDGFK LLEIGLEMDL PVITHSDYDS VMKGIIHGAC DYLVKPVGLK
ELQNIWHHVV KKNIKSYAKL LPPSESDSVP SASRKRKDKV NDSGDEDDSD REEDDGEGSE
QDGDGSGTRK KPRVVWSQEL HQKFVSAVQQ LGLDKAVPKK ILDLMSIEGL TRENVASHLQ
KYRLYLKKID EGQQQNMTPD AFGTRDSSYF QMAQLDGLRD FTAARQIPSS GLLSRSHLTK
LQPPMYSSIN LQGMNSSSFI QQGHHQNSSN SANPFGTYHS TLSPRIQNVN LFQRTSSPLE
PLQFPRSKSY IGDFKGLGDR AIGGSFLDTC MPFGSSSTSL PSASTNPLML QANYTQPLHI
ASDGIQPCIE GTPSNSASPN ISFQGLSRFP GHSWQGNLNT TRFPPSSLPL NLAFLPDQVT
CAGNNLGDCT SLVSAENPGG EMQCDPQLLG GFMQNVNPLG GQKWEQQNCT MLNNPFGNIE
YPLPADNMVF RDNNSTRSKG LDESLMNPID NSQEYVGKAT TMLDPEMKSG KPENDNQHDV
FDDIMNEMMK QEENNGMVPV ATRFGFDSFP PP
Length = 632 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At5g58080

>At5g58080 ARR2 - like protein
          Length = 632

 Score =  112 bits (282), Expect = 3e-26
 Identities = 45/59 (76%), Positives = 56/59 (94%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRL 59
           KPRVVWS ELHQ+FV+AV QLG++KAVPKKIL+LM++ GLTRENVASHLQKYR+YL+++
Sbjct: 191 KPRVVWSQELHQKFVSAVQQLGLDKAVPKKILDLMSIEGLTRENVASHLQKYRLYLKKI 249


InterPro Results:

IPR001005 Domain
PF00249 T[193-243] 9.1e-14 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[18-122] 9e-45 sp_Q9FGT7_ARATH_Q9FGT7;
PF00072 T[18-134] 2.5e-14 Response_reg
SM00448 T[18-126] 1.5e-18 REC
PS50110 T[19-130] 23.797 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[191-246] 4.4e-33 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[187-250] 9.3e-21 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[17-132] 1.6e-23 CheY-like
CheY-like
NULL
seg ?[29-41]?[162-187]?[395-408] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class112 3e-26
TF_10_1 GARPG2-like112 6e-25
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 78 2e-14
TF_1_2 MYB superfamilyLHY 74 3e-13

TOP