AGI ID: At5g57720

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At5g57720
MVLENGFPPY PDFLKIFNSH EDSQLLVIPR SYNRYYPNPL PQTAVLKNPE GRFWNVQWTK
SQEVIISLQE GWVKFVKDNG LIDRDFLLFT YDGSRSFWVR IHRNGLPLEP TAPIKIQEIS
DDEDETNGDG DPHMEEEGDT DENMIVSLSL GSSDEVGDDD DDDYDTAICD EVNKASGSSK
KGRVTRKHRD DSLASITPQI FLADPNNPFF ISTSSCSRRI LVIARQVIKD YGLNFDGTVN
LIDGFGELTR KVGKWKDRVV IYKWNEMFTR NKVKQGDVII CEIIREEDVV RSIKVHFVKN
Length = 300 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g57720

>At5g57720 putative protein
          Length = 300

 Score = 71.9 bits (175), Expect = 1e-12
 Identities = 22/107 (20%), Positives = 39/107 (35%), Gaps = 11/107 (10%)

Query: 566 NLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRF 625
                  K+   S   +   +V+P+     +   L        A+      R WN+    
Sbjct: 8   PPYPDFLKI-FNSHEDSQL-LVIPRSYNRYYPNPL-----PQTAVLKNPEGRFWNV---Q 57

Query: 626 WPNNKS-RMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQP 671
           W  ++   + L E    FVK NGL + DF++   D      V++ + 
Sbjct: 58  WTKSQEVIISLQEGWVKFVKDNGLIDRDFLLFTYDGSRSFWVRIHRN 104


InterPro Results:

IPR003340 Family
PF02362 T[12-107] 1.2e-21 B3
Transcriptional factor B3
NULL
seg ?[146-165] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 72 1e-12

TOP