AGI ID: At5g51990

TF ID:TF_2_4
Super family:AP2/EREBP
Sub family:CBF1
Gene name: AP2 domain transcription factor-like protein

Amino Acid Sequence:


1
61
121
181
>At5g51990
MNPFYSTFPD SFLSISDHRS PVSDSSECSP KLASSCPKKR AGRKKFRETR HPIYRGVRQR
NSGKWVCEVR EPNKKSRIWL GTFPTVEMAA RAHDVAALAL RGRSACLNFA DSAWRLRIPE
TTCPKEIQKA ASEAAMAFQN ETTTEGSKTA AEAEEAAGEG VREGERRAEE QNGGVFYMDD
EALLGMPNFF ENMAEGMLLP PPEVGWNHND FDGVGDVSLW SFDE
Length = 224 AA.

PSI BLAST Result:

Query: Query sequence of TF_2_4
Sbjct: At5g51990

>At5g51990 AP2 domain transcription factor-like protein
          Length = 224

 Score =  203 bits (516), Expect = 6e-53
 Identities = 90/206 (43%), Positives = 112/206 (53%), Gaps = 15/206 (7%)

Query: 5   DIILAEMRPKKRAGRRVFKETRHPVYRGIRRRNGDKWVCEVREPTHQRRIWLGTYPTADM 64
              LA   PKKRAGR+ F+ETRHP+YRG+R+RN  KWVCEVREP  + RIWLGT+PT +M
Sbjct: 29  SPKLASSCPKKRAGRKKFRETRHPIYRGVRQRNSGKWVCEVREPNKKSRIWLGTFPTVEM 88

Query: 65  AARAHDVAVLALRGRSACLNFADSAWRLPVPESNDPDVIRRVAAEAAEMFRPVDLESGIT 124
           AARAHDVA LALRGRSACLNFADSAWRL +PE+  P  I++ A+EAA  F+        T
Sbjct: 89  AARAHDVAALALRGRSACLNFADSAWRLRIPETTCPKEIQKAASEAAMAFQNE----TTT 144

Query: 125 VLPCAGDDVDLXXXXXXXXXXXXXXXXXXXXXFGDYEE---VSTTMMRLAEGPLMSPPRS 181
                  + +                      + D E    +      +AEG L+ PP  
Sbjct: 145 EGSKTAAEAEEAAGEGVREGERRAEEQNGGVFYMDDEALLGMPNFFENMAEGMLLPPPEV 204

Query: 182 YMEDMTPTNVYTEEEMCYEDMSLWSY 207
                    V         D+SLWS+
Sbjct: 205 GWNHNDFDGV--------GDVSLWSF 222


InterPro Results:

IPR001471 Domain
PD001423 T[60-88] 4e-11 sp_Q9FJ93_ARATH_Q9FJ93;
PR00367 T[54-65] 7.4e-10T[76-92] 7.4e-10 ETHRSPELEMNT
PF00847 T[52-115] 1.6e-38 AP2
SM00380 T[53-116] 6.8e-31 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[89-101]?[141-170] seg
SSF54171 T[52-112] 1.4e-23 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_2_4 AP2/EREBPCBF1203 6e-53
TF_2_3 AP2/EREBPAPETALA2140 2e-33
TF_67 Pti6131 2e-31
TF_2_2 AP2/EREBPAINTEGUMENTA132 4e-31
TF_68 ERF117 4e-27
TF_65 Pti4106 1e-23
TF_66 Pti5101 1e-22
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4102 4e-22
TF_2_5 AP2/EREBPDREB2A101 5e-22

TOP