AGI ID: At5g49240

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At5g49240
MQPLNMAEIL DHRGVLTDGD DGPFRNLTNF YDMFSSNFPE GLRVLVFDED PSYLLILERH
LQKFQYQVTI CNEVNKAMHT LRNHRNRFDL AMIQVNNAEG DIFRFLSEIG SEMDLPIIII
SEDDSVKSVK KWMINGAADY LIKPIRPEDL RIVFKHLVKK MRERRSVVTG EAEKAAGEKS
SSVGDSTIRN PNKSKRSSCL EAEVNEEDRH DHNDRACASS AKKRRVVWDE ELHQNFLNAV
DFLGLERAVP KKILDVMKVD YISRENVASH LQVTFLIYNI IVHFQQHFCF YS
Length = 292 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g49240

>At5g49240 putative protein
          Length = 292

 Score = 85.1 bits (209), Expect = 1e-16
 Identities = 25/56 (44%), Positives = 36/56 (63%), Gaps = 1/56 (1%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQ 237
           A+   K R+ W  ELH  F+NAV+ L G ++A PK IL +M VD ++  ++ SHLQ
Sbjct: 218 ASSAKKRRVVWDEELHQNFLNAVDFL-GLERAVPKKILDVMKVDYISRENVASHLQ 272


InterPro Results:

IPR001005 Domain
PF00249 T[225-275] 3.1e-06 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[43-151] 5e-57 sp_Q9FJ16_ARATH_Q9FJ16;
PF00072 T[42-162] 1.6e-06 Response_reg
SM00448 T[42-154] 4.1e-07 REC
PS50110 T[43-158] 21.023 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[223-278] 7e-34 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[219-279] 1.7e-15 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[37-165] 4.4e-21 CheY-like
CheY-like

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like 85 1e-16
TF_10_2 GARPARR-B class 80 2e-16
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 60 4e-09
TF_1_2 MYB superfamilyLHY 52 9e-07

TOP