AGI ID: At5g47220

TF ID:TF_65
Super family:Pti4
Sub family:
Gene name: ethylene responsive element binding factor 2 (ATERF2) ...

Amino Acid Sequence:


1
61
121
181
241
>At5g47220
MYGQCNIESD YALLESITRH LLGGGGENEL RLNESTPSSC FTESWGGLPL KENDSEDMLV
YGLLKDAFHF DTSSSDLSCL FDFPAVKVEP TENFTAMEEK PKKAIPVTET AVKAKHYRGV
RQRPWGKFAA EIRDPAKNGA RVWLGTFETA EDAALAYDIA AFRMRGSRAL LNFPLRVNSG
EPDPVRITSK RSSSSSSSSS SSTSSSENGK LKRRRKAENL TSEVVQVKCE VGDETRVDEL
LVS
Length = 243 AA.

PSI BLAST Result:

Query: Query sequence of TF_65
Sbjct: At5g47220

>At5g47220 ethylene responsive element binding factor 2 (ATERF2) (sp|O80338)
          Length = 243

 Score =  198 bits (503), Expect = 3e-51
 Identities = 98/216 (45%), Positives = 116/216 (53%), Gaps = 24/216 (11%)

Query: 29  CLTEKWGDLPLKVDDSEDMVIYGLLKDALSVGWSP------FNFTAGEVKXXXXXXXXXX 82
           C TE WG LPLK +DSEDM++YGLLKDA     S       F+F A +V+          
Sbjct: 40  CFTESWGGLPLKENDSEDMLVYGLLKDAFHFDTSSSDLSCLFDFPAVKVE------PTEN 93

Query: 83  XXXXXXXXXXXXXXXXXXXKGRHYRGVRQRPWGKFAAEIRDPAKNGARVWLGXXXXXXXX 142
                              K +HYRGVRQRPWGKFAAEIRDPAKNGARVWLG        
Sbjct: 94  FTAMEEKPKKAIPVTETAVKAKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDA 153

Query: 143 XXXXXXXXXRMRGSKAHLNFPHRIGLNEPEPVRVTAKR-----RASPEPASSSGNGSMKR 197
                    RMRGS+A LNFP R+   EP+PVR+T+KR      +S    SSS NG +KR
Sbjct: 154 ALAYDIAAFRMRGSRALLNFPLRVNSGEPDPVRITSKRSSSSSSSSSSSTSSSENGKLKR 213

Query: 198 RRKAVQKCDGEMASRSSVMQVGCQIEQLTGVHQLLV 233
           RRKA           S V+QV C++   T V +LLV
Sbjct: 214 RRKAENLT-------SEVVQVKCEVGDETRVDELLV 242


InterPro Results:

IPR001471 Domain
PD001423 T[123-177] 3e-18 sp_ERFI_ARATH_O80337;
PR00367 T[117-128] 4e-12T[140-156] 4e-12 ETHRSPELEMNT
PF00847 T[115-179] 1.3e-42 AP2
SM00380 T[116-180] 5.3e-41 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
seg ?[21-34]?[150-161]?[192-206] seg
SSF54171 T[115-177] 1.9e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_65 Pti4198 3e-51
TF_2_2 AP2/EREBPAINTEGUMENTA131 8e-31
TF_2_4 AP2/EREBPCBF1122 1e-28
TF_67 Pti6120 7e-28
TF_68 ERF118 2e-27
TF_66 Pti5114 2e-26
TF_2_3 AP2/EREBPAPETALA2109 4e-24
TF_2_5 AP2/EREBPDREB2A 91 7e-19
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 89 3e-18

TOP