AGI ID: At5g45580

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g45580
MERVNLGGLG YDNGGVMMTR DPKPRLRWTA DLHDRFVDAV AKLGGADKAT PKSVLKLMGL
KGLTLYHLKS HLQKYRLGQQ QGKKQNRTEQ NKENAGSSYV HFDNCSQGGI SNDSRFDNHQ
RYIIYEFAFS RHNGFVKLEF DIMLMNTRRQ SGNVPFAEAM RHQVDAQQRF QEQLEVQKKL
QMRMEAQGKY LLTLLEKAQK SLPCGNAGET DKGQFSDFNL ALSGLVGSDR KNEKAGLVTD
ISHLNGGDSS QEFRLCGEQE KIETGDACVK PESGFVHFDL NSKSGYDLLN CGKYGIEVKP
NVIGDRLQ
Length = 308 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g45580

>At5g45580 putative protein
          Length = 308

 Score =  110 bits (275), Expect = 3e-24
 Identities = 42/59 (71%), Positives = 49/59 (82%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
           T   K RLRWT +LH+RFV+AV  LGG DKATPK +LKLMG+ GLT+YH+KSHLQKYRL
Sbjct: 19  TRDPKPRLRWTADLHDRFVDAVAKLGGADKATPKSVLKLMGLKGLTLYHLKSHLQKYRL 77



 Score = 79.7 bits (195), Expect = 6e-15
 Identities = 17/44 (38%), Positives = 32/44 (72%)

Query: 387 EALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           EA+  Q++ Q++  EQLE Q++LQ+ +EA G+Y+ +L+E+   +
Sbjct: 158 EAMRHQVDAQQRFQEQLEVQKKLQMRMEAQGKYLLTLLEKAQKS 201


InterPro Results:

IPR001005 Domain
PF00249 T[25-76] 1.1e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[23-79] 7.6e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[19-83] 4.4e-18 Homeodomain-like
Homeodomain-like

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like110 3e-24
TF_10_2 GARPARR-B class 94 9e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 73 4e-13
TF_1_2 MYB superfamilyLHY 70 6e-12

TOP