AGI ID: At5g44190

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g44190
MLTVSPAPVL IGNNSKDTYM AADFADFTTE DLPDFTTVGD FSDDLLDGID YYDDLFIGFD
GDDVLPDLEI DSEILGEYSG SGRDEEQEME GNTSTASETS ERDVGVCKQE GGGGGDGGFR
DKTVRRGKRK GKKSKDCLSD ENDIKKKPKV DWTPELHRKF VQAVEQLGVD KAVPSRILEI
MNVKSLTRHN VASHLQKYRS HRKHLLAREA EAASWNLRRH ATVAVPGVGG GGKKPWTAPA
LGYPPHVAPM HHGHFRPLHV WGHPTWPKHK PNTPASAHRT YPMPAIAAAP ASWPGHPPYW
HQQPLYPQGY GMASSNHSSI GVPTRQLGPT NPPIDIHPSN ESIDAAIGDV ISKPWLPLPL
GLKPPSVDGV MTELQRQGVS NVPPLP
Length = 386 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At5g44190

>At5g44190 unknown protein
          Length = 386

 Score =  107 bits (268), Expect = 1e-24
 Identities = 39/59 (66%), Positives = 48/59 (81%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRL 59
           KP+V W+ ELH++FV AV QLGV+KAVP +ILE+MNV  LTR NVASHLQKYR + + L
Sbjct: 147 KPKVDWTPELHRKFVQAVEQLGVDKAVPSRILEIMNVKSLTRHNVASHLQKYRSHRKHL 205


InterPro Results:

IPR001005 Domain
PF00249 T[149-199] 3.3e-12 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[147-202] 4e-35 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR008990 Domain
SSF50090 T[274-337] 5.7e-11 Electron transport accessory proteins
Electron transport accessory protein
IPR009057 Domain
SSF46689 T[143-205] 5.6e-19 Homeodomain-like
Homeodomain-like
NULL
seg ?[43-58]?[111-118]?[120-136]?[225-235]?[353-365] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class107 1e-24
TF_10_1 GARPG2-like107 3e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 71 2e-12
TF_1_2 MYB superfamilyLHY 67 4e-11

TOP