AGI ID: At5g42630

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g42630
MMMLESRNSM RASNSVPDLS LQISLPNYHA GKPLHGGDRS STSSDSGSSL SDLSHENNFF
NKPLLSLGFD HHHQRRSNMF QPQIYGRDFK RSSSSMVGLK RSIRAPRMRW TSTLHAHFVH
AVQLLGGHER ATPKSVLELM NVKDLTLAHV KSHLQMYRTV KCTDKGSPGE GKVEKEAEQR
IEDNNNNEEA DEGTDTNSPN SSSVQKTQRA SWSSTKEVSR SISTQAYSHL GTTHHTKDNE
EKEDTNIHLN LDFTLGRPSW GMEYAEPSSD LTLLKC
Length = 276 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g42630

>At5g42630 unknown protein
          Length = 276

 Score =  106 bits (264), Expect = 6e-23
 Identities = 31/60 (51%), Positives = 39/60 (64%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
                  R+RWT  LH  FV+AV  LGG ++ATPK +L+LM V  LT+ H+KSHLQ YR 
Sbjct: 100 KRSIRAPRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 159


InterPro Results:

IPR001005 Domain
PF00249 T[107-158] 2.8e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[105-161] 1.6e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[103-165] 5.5e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[36-54]?[182-192] seg
SSF55486 T[66-102] 0.015 Metalloproteases ("zincins"), catalytic domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like106 6e-23
TF_10_2 GARPARR-B class 82 4e-17
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 61 2e-09
TF_1_2 MYB superfamilyLHY 55 9e-08

TOP