AGI ID: At5g38500

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g38500
MDSGKDMWSR LCLLAETVVM AAEEEEQRRR LLAEKREDSK SQKKTVSEED DSEKRFLSHV
PRKKRSSLVK RQQKPNGVST SSSSLPDLNQ IPIDYETETK QNPSFIERLV CDEEQRVKKG
KSRIIWEEEE EADEDSEKRL FEKNLMKFVG HSQQQQKFET LNGASSSSSF LNLRCYEASL
FLDYNTVESE KTETKVLPNP NYQSSSPSSC LTENDTSRKR RAVEQRKSGK VKKVKVSPLP
RLSTETPEWV FQAMGHMNAD AETPKLIFER TLFKSDVNSN LSRLLIPFQK LIRNDFLTPE
ECRAMQEDKD KDDEDISVGT ILVCQAKQED EDKDDEDIGA GTILVNQRFK MWGLRFKIWG
MEKDSGHGTL NYILNWDWND VVKGNSLKAG DNIGLWTFRC RGVLCFALDT W
Length = 411 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At5g38500

>At5g38500 putative protein
          Length = 411

 Score =  110 bits (275), Expect = 5e-24
 Identities = 21/169 (12%), Positives = 40/169 (23%), Gaps = 43/169 (25%)

Query: 99  LQPVNKYDRDALLASDMGLK-LNRQPNEFFCKTLTASDT-STHGGFSVPRRAAEK--IFP 154
           L  ++    + +  +   +      P   F +TL  SD  S      +P +   +     
Sbjct: 239 LPRLSTETPEWVFQAMGHMNADAETPKLIFERTLFKSDVNSNLSRLLIPFQKLIRNDFLT 298

Query: 155 ALDFSMQP-------------------------------PCQELVAKDIHDNTWTFRHIY 183
             +                                         +  +     W  R   
Sbjct: 299 PEECRAMQEDKDKDDEDISVGTILVCQAKQEDEDKDDEDIGAGTILVNQRFKMWGLRFKI 358

Query: 184 RGQPK-------RHLLTTGWSVFVSTKRLFAGDSVLFIRDG-KAQLLLG 224
            G  K        ++L   W+  V    L AGD++       +  L   
Sbjct: 359 WGMEKDSGHGTLNYILNWDWNDVVKGNSLKAGDNIGLWTFRCRGVLCFA 407


InterPro Results:

IPR005508 Domain
PF03754 T[244-384] 9.3e-77 DUF313
Protein of unknown function DUF313
NULL
coil ?[22-43] coiled-coil
seg ?[15-37]?[127-137]?[204-209]?[230-236]?[329-337] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7110 5e-24
TF_22_1 ABI3/VP1FUSCA3 99 4e-21
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3100 5e-21

TOP