AGI ID: At5g38490

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g38490
MSSIMYHDNH LTDSGKNMSS GLSLLAYVTV MVAEEEEQRS RLLAEKREES KCKMSFFYLF
PRKIKSSLAK RRYTQQNPNG ASTCSSSLPD LNLIPTDFET DNLQNPCFDE PMVCDEEQRL
KKGKSKIVYD EDYDDESEKK LFDNLNGAST SSSSLLNLPC LEPSTETKDV PNPNYQSSSP
SSCLTGKTNR KRRAVEQRKS GKVKKVKVSP LPRLCTEMPE WIFQVMRYMN ADAETPRLIF
ERTLFKSDVN SNLSRLLMPF QKLIRNDFLT PAECRAMQKD EDNDEEDDEN IGVGTVLVNQ
RFQKWGLRFK IWAMEKDSGH GTLNYTLNWG WNDVVKSSSL KVGDKISLWT FRCRGVLCFA
LDTE
Length = 364 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At5g38490

>At5g38490 putative protein
          Length = 364

 Score =  120 bits (301), Expect = 5e-27
 Identities = 21/150 (14%), Positives = 36/150 (24%), Gaps = 24/150 (16%)

Query: 99  LQPVNKYDRDALLASDMGLK-LNRQPNEFFCKTLTASDT-STHGGFSVPRRAAEK--IFP 154
           L  +     + +      +      P   F +TL  SD  S      +P +   +     
Sbjct: 211 LPRLCTEMPEWIFQVMRYMNADAETPRLIFERTLFKSDVNSNLSRLLMPFQKLIRNDFLT 270

Query: 155 ALDFSMQPP------------CQELVAKDIHDNTWTFRHIYRGQPK-------RHLLTTG 195
             +                      V  +     W  R       K        + L  G
Sbjct: 271 PAECRAMQKDEDNDEEDDENIGVGTVLVNQRFQKWGLRFKIWAMEKDSGHGTLNYTLNWG 330

Query: 196 WSVFVSTKRLFAGDSVLFIRDG-KAQLLLG 224
           W+  V +  L  GD +       +  L   
Sbjct: 331 WNDVVKSSSLKVGDKISLWTFRCRGVLCFA 360


InterPro Results:

IPR005508 Domain
PF03754 T[216-337] 8.6e-72 DUF313
Protein of unknown function DUF313
NULL
coil ?[33-54] coiled-coil
seg ?[129-136]?[177-182]?[202-208]?[280-290] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7120 5e-27
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3108 1e-23
TF_22_1 ABI3/VP1FUSCA3101 5e-22

TOP