AGI ID: At5g37020

TF ID:TF_17_1
Super family:ARF
Sub family:MONOPTEROS/ARF5
Gene name: auxin response factor 8 (ARF8)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
>At5g37020
MKLSTSGLGQ QGHEGEKCLN SELWHACAGP LVSLPSSGSR VVYFPQGHSE QVAATTNKEV
DGHIPNYPSL PPQLICQLHN VTMHADVETD EVYAQMTLQP LTPEEQKETF VPIELGIPSK
QPSNYFCKTL TASDTSTHGG FSVPRRAAEK VFPPLDYTLQ PPAQELIARD LHDVEWKFRH
IFRGQPKRHL LTTGWSVFVS AKRLVAGDSV IFIRNEKNQL FLGIRHATRP QTIVPSSVLS
SDSMHIGLLA AAAHASATNS CFTVFFHPRA SQSEFVIQLS KYIKAVFHTR ISVGMRFRML
FETEESSVRR YMGTITGISD LDSVRWPNSH WRSVKVGWDE STAGERQPRV SLWEIEPLTT
FPMYPSLFPL RLKRPWHAGT SSLPDGRGDL GSGLTWLRGG GGEQQGLLPL NYPSVGLFPW
MQQRLDLSQM GTDNNQQYQA MLAAGLQNIG GGDPLRQQFV QLQEPHHQYL QQSASHNSDL
MLQQQQQQQA SRHLMHAQTQ IMSENLPQQN MRQEVSNQPA GQQQQLQQPD QNAYLNAFKM
QNGHLQQWQQ QSEMPSPSFM KSDFTDSSNK FATTASPASG DGNLLNFSIT GQSVLPEQLT
TEGWSPKASN TFSEPLSLPQ AYPGKSLALE PGNPQNPSLF GVDPDSGLFL PSTVPRFASS
SGDAEASPMS LTDSGFQNSL YSCMQDTTHE LLHGAGQINS SNQTKNFVKV YKSGSVGRSL
DISRFSSYHE LREELGKMFA IEGLLEDPLR SGWQLVFVDK ENDILLLGDD PWESFVNNVW
YIKILSPEDV HQMGDHGEGS GGLFPQNPTH L
Length = 811 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_1
Sbjct: At5g37020

>At5g37020 auxin response factor 8 (ARF8)
          Length = 811

 Score =  739 bits (1909), Expect = 0.0
 Identities = 270/648 (41%), Positives = 377/648 (57%), Gaps = 42/648 (6%)

Query: 40  LKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNY 99
           L  Q    +  +NSELWHACAGPLV LP  GS V YF QGHSEQVA +T +     +PNY
Sbjct: 8   LGQQGHEGEKCLNSELWHACAGPLVSLPSSGSRVVYFPQGHSEQVAATTNKEVDGHIPNY 67

Query: 100 PNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFC 159
           P+LP QL+CQ+HNVT+HAD ++DE+YAQM+LQP+  E          +   SK P+ +FC
Sbjct: 68  PSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLTPEEQKETFVPIELGIPSKQPSNYFC 127

Query: 160 KTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPK 219
           KTLTASDTSTHGGFSVPRRAAEK+FPPLDY+ QPP QEL+ RDLH+  W FRHI+RGQPK
Sbjct: 128 KTLTASDTSTHGGFSVPRRAAEKVFPPLDYTLQPPAQELIARDLHDVEWKFRHIFRGQPK 187

Query: 220 RHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIG 279
           RHLLTTGWS+FV +KRL AGDSV+FIR+EK+QL +G+R A R QT +PSSVLS+DSMHIG
Sbjct: 188 RHLLTTGWSVFVSAKRLVAGDSVIFIRNEKNQLFLGIRHATRPQTIVPSSVLSSDSMHIG 247

Query: 280 VLXXXXXXXXNRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSG 339
           +L          + F +F++PRA  +EFVI L+KY KA+  +++SVGMRF M+FETE+S 
Sbjct: 248 LLAAAAHASATNSCFTVFFHPRASQSEFVIQLSKYIKAVFHTRISVGMRFRMLFETEESS 307

Query: 340 KRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSL 399
            RRYMGTI GISDLD +RWP S WR+++V WDE    ++  RVS W+IE   +  ++PSL
Sbjct: 308 VRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSL 367

Query: 400 TS-GLKRQLH---PSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMK--- 452
               LKR  H    S   G  + GS +    +R        +   ++PS+     M+   
Sbjct: 368 FPLRLKRPWHAGTSSLPDGRGDLGSGLT--WLRGGGGEQQGLLPLNYPSVGLFPWMQQRL 425

Query: 453 --MMMRPHNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQP--------------LMMNQK 496
               M   NNQ   + ++   QNI  G+      +++Q+P              LM+ Q+
Sbjct: 426 DLSQMGTDNNQQYQAMLAAGLQNIGGGDPLRQQFVQLQEPHHQYLQQSASHNSDLMLQQQ 485

Query: 497 SEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGC------SSGRVQHGLE 550
            +    ++ +       + +  +QN+ Q +S     +   L         ++ ++Q+G  
Sbjct: 486 QQQQASRHLMHAQTQIMSENLPQQNMRQEVSNQPAGQQQQLQQPDQNAYLNAFKMQNGHL 545

Query: 551 QSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCL---DITHQIYQPQSDPINGFS 607
           Q  +Q S++ + +    +  +   +    +SP   D  L    IT Q   P+     G+S
Sbjct: 546 QQWQQQSEMPSPSFMKSDFTDSSNKFATTASPASGDGNLLNFSITGQSVLPEQLTTEGWS 605

Query: 608 FLETDELTSQVSSFQ-----SLA---GSYKQPFILSSQDSSAVVLPDS 647
              ++  +  +S  Q     SLA   G+ + P +      S + LP +
Sbjct: 606 PKASNTFSEPLSLPQAYPGKSLALEPGNPQNPSLFGVDPDSGLFLPST 653


InterPro Results:

IPR001827 Domain
PS00032 ?[417-422] NA ANTENNAPEDIA
Homeobox protein, antennapedia type
IPR003340 Family
PF02362 T[125-230] 3.3e-23 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[252-335] 3.8e-54 Auxin_resp
Auxin response factor
NULL
seg ?[250-257]?[390-408]?[483-489]?[518-531] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_1 ARFMONOPTEROS/ARF5739 0.0
TF_17_2 ARFNPH4/ARF7575 e-164
TF_17_3 ARFETTIN/ARF3524 e-149
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3139 6e-33
TF_22_1 ABI3/VP1FUSCA3120 1e-27
TF_55 Aux/IAA112 2e-25

TOP