AGI ID: At5g35780

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g35780
MTMYDLTDSG KDMCSSLCLL AEVAVMVAEE EQFRRLLKTV SKEEDSDKSF FYRFPRKIRS
SLVKRRYTQQ NPNGASTSSA VLDLNLITTD YDLKTQQNPS FDEPMSIETP EWVFQVMRYM
NADAETPRLI FERTLFNSDV KSGLSRLLIP FQQLIRNDFL TPAECRAIQK DEDNEDDKNI
GVGTILVNQR SKMWGLRFKI WAMEKDSGHG TLNYILNWGW NDVVKGNGLK AGDNISLWTF
RCRGVLCFPL ET
Length = 252 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g35780

>At5g35780 unknown protein
          Length = 252

 Score =  129 bits (324), Expect = 7e-30
 Identities = 30/157 (19%), Positives = 55/157 (34%), Gaps = 23/157 (14%)

Query: 532 METQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGN-LGRIVLPK 590
           ++TQ         +   P       R       +  R + ++ L  SDV + L R+++P 
Sbjct: 93  LKTQQNPSFDEPMSIETPEWVFQVMRYMN-ADAETPRLIFERTLFNSDVKSGLSRLLIPF 151

Query: 591 KEAET--HLPELEAR------------DGISLAMEDIGTSRVWNMRYRFWPNNKSR---- 632
           ++      L   E R            +     +     S++W +R++ W   K      
Sbjct: 152 QQLIRNDFLTPAECRAIQKDEDNEDDKNIGVGTILVNQRSKMWGLRFKIWAMEKDSGHGT 211

Query: 633 --MYLLENTGDFVKTNGLQEGDFIVIY-SDVKLIRGV 666
               L     D VK NGL+ GD I ++    + +   
Sbjct: 212 LNYILNWGWNDVVKGNGLKAGDNISLWTFRCRGVLCF 248


InterPro Results:

IPR005508 Domain
PF03754 T[107-226] 5.4e-71 DUF313
Protein of unknown function DUF313
NULL
seg ?[21-31] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3129 7e-30
TF_17_2 ARFNPH4/ARF7125 1e-28
TF_22_1 ABI3/VP1FUSCA3107 9e-24
TF_17_3 ARFETTIN/ARF3 43 7e-04

TOP