AGI ID: At5g32460

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: meristem protein - like

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At5g32460
MTDAMFSSSA KPHFIKPMLP GFETYIVIPK AFYSNYLEGR QEGNAAELRS DATEITWKIK
IDGRRMTKGW EEFAVAHNLQ VDDILVFRHE GNLLFHVTPF GLSFCEILYS QRDEKDVKDT
TGKVTRSRTV KKNGKNECSS VDTDFVVPVT ASNQRVDSFY LPRGFTTSSG SSKLCNEIIL
IDEKDRPSTL KLRYNKSSNR FCVSRGWRAF CCRNGYRTGC FLRIILVRKG KTPVLRIFPL
ERDEDNIEHE ESVKEETNVE SGKLKRDRLL QKDPKNLCST SQDTNFVVPV TASNQRHDSF
HLPKGLTTSS GLSKLCKKII FMDQKGRSSI LDLSYSISDD RFTVRRGWKA FCCRNEHKTG
CFLRLILVQN GKTPECNVYE GTFSIPAKNS KKIKQEVEYE SAKEEKNLES LSLSDNSSFV
VSVTVSNLSE DILHLPIRLS RSNLLDKKIH EIVLMNKEGR TWILSLKYSK YSGRFRITRG
WKSFCEANGQ KPGCTFLLKL HLSMTRFDQD GVAWDKK
Length = 517 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g32460

>At5g32460 meristem protein - like
          Length = 517

 Score = 69.9 bits (170), Expect = 5e-12
 Identities = 20/149 (13%), Positives = 42/149 (27%), Gaps = 28/149 (18%)

Query: 538 TMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVG-----------NLGRI 586
               +  A    + +      +  K EKNL       L  SD             +   +
Sbjct: 380 EGTFSIPAKNSKKIKQEV-EYESAKEEKNLE-----SLSLSDNSSFVVSVTVSNLSEDIL 433

Query: 587 VLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTN 646
            LP + + ++L        I   +      R W +  ++      R  +      F + N
Sbjct: 434 HLPIRLSRSNL----LDKKIHEIVLMNKEGRTWILSLKY-SKYSGRFRITRGWKSFCEAN 488

Query: 647 GLQEGDFIVIYSDVKLIRGVKVRQPSGQK 675
           G + G   ++         + + +     
Sbjct: 489 GQKPGCTFLL------KLHLSMTRFDQDG 511



 Score = 66.1 bits (160), Expect = 6e-11
 Identities = 16/161 (9%), Positives = 41/161 (24%), Gaps = 13/161 (8%)

Query: 532 METQLPTMD--RAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLP 589
           + +Q    D           R      + +    + +        +  S+        LP
Sbjct: 108 LYSQRDEKDVKDTTGKVTRSRTVKKNGKNECSSVDTD----FVVPVTASNQRVDS-FYLP 162

Query: 590 KKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQ 649
           +           +    +  +      R   ++ R+  ++            F   NG +
Sbjct: 163 RGF----TTSSGSSKLCNEIILIDEKDRPSTLKLRYNKSSNRFCV-SRGWRAFCCRNGYR 217

Query: 650 EGDFIVIYSDVKLI-RGVKVRQPSGQKPEAPPSSAATKRQN 689
            G F+ I    K     +++      +       +  +  N
Sbjct: 218 TGCFLRIILVRKGKTPVLRIFPLERDEDNIEHEESVKEETN 258



 Score = 53.4 bits (127), Expect = 5e-07
 Identities = 20/107 (18%), Positives = 36/107 (32%), Gaps = 14/107 (13%)

Query: 564 EKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMED-IGTSRVWNMR 622
             + +    K +     G    IV+PK     +L   E R   + A      T   W ++
Sbjct: 7   SSSAKPHFIKPMLP---GFETYIVIPKAFYSNYL---EGRQEGNAAELRSDATEITWKIK 60

Query: 623 YRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVR 669
                 +  R  + +   +F   + LQ  D +V   +  L+  V   
Sbjct: 61  I-----DGRR--MTKGWEEFAVAHNLQVDDILVFRHEGNLLFHVTPF 100



 Score = 47.2 bits (111), Expect = 3e-05
 Identities = 14/138 (10%), Positives = 31/138 (22%), Gaps = 20/138 (14%)

Query: 540 DRAGSASAMPRQQVVPDRRQGWKPE------KNLRFL--------LQKVLKQSDVGNLGR 585
           +R                 +  K +      K+ + L            +  S+  +   
Sbjct: 241 ERDEDNIEHEESVKEETNVESGKLKRDRLLQKDPKNLCSTSQDTNFVVPVTASNQRHDS- 299

Query: 586 IVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKT 645
             LPK                   +      R   +   +  ++  R  +      F   
Sbjct: 300 FHLPKG----LTTSSGLSKLCKKIIFMDQKGRSSILDLSYSISD-DRFTVRRGWKAFCCR 354

Query: 646 NGLQEGDFIVIYSDVKLI 663
           N  + G F+ +       
Sbjct: 355 NEHKTGCFLRLILVQNGK 372


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 9.4e-20T[144-244] 2.1e-17T[285-377] 2.7e-08T[418-517] 2.3e-17 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[55-107] 9e-05 Cupredoxins
Cupredoxin
NULL
coil ?[240-261] coiled-coil
seg ?[328-340]?[400-429] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 70 5e-12
TF_22_1 ABI3/VP1FUSCA3 65 5e-11

TOP