AGI ID: At5g29000

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g29000
MTLANDFGYS TAMSSSYSAL HTSVEDRYHK LPNSFWVSSG QELMNNPVPC QSVSGGNSGG
YLFPSSSGYC NVSAVLPHGR NLQNQPPVST VPRDRLAMQD CPLIAQSSLI NHHPQEFIDP
LHEFFDFSDH VPVQNLQAES SGVRVDSSVE LHKKSEWQDW ADQLISVDDG SEPNWSELLG
DSSSHNPNSE IPTPFLDVPR LDITANQQQQ MVSSEDQLSG RNSSSSVATS KQRMRWTPEL
HEAFVEAVNQ LGGSERATPK AVLKLLNNPG LTIYHVKSHL QKYRTARYKP ETSEVTGEPQ
EKKMTSIEDI KSLDMKTSVE ITQALRLQME VQKRLHEQLE IQRSLQLQIE KQGRYLQMMF
EKQQKIQDNK SSSSEASPKQ CNGSFAEVEV GLETLTGDQN ESASASRKRV RED
Length = 413 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g29000

>At5g29000 unknown protein
          Length = 413

 Score =  124 bits (311), Expect = 2e-28
 Identities = 39/68 (57%), Positives = 48/68 (70%)

Query: 179 QRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQK 238
             ++   +K R+RWTPELH  FV AVN LGG ++ATPK +LKL+   GLTIYH+KSHLQK
Sbjct: 223 SSSSVATSKQRMRWTPELHEAFVEAVNQLGGSERATPKAVLKLLNNPGLTIYHVKSHLQK 282

Query: 239 YRLNIRLP 246
           YR     P
Sbjct: 283 YRTARYKP 290



 Score = 92.8 bits (229), Expect = 7e-19
 Identities = 23/45 (51%), Positives = 32/45 (71%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGL 429
           + +AL  QME+QK+LHEQLE QR LQL +E  GRY+  + E++  
Sbjct: 321 ITQALRLQMEVQKRLHEQLEIQRSLQLQIEKQGRYLQMMFEKQQK 365


InterPro Results:

IPR000905 Domain
PS01016 ?[260-280] NA GLYCOPROTEASE
Peptidase M22, glycoprotease
IPR001005 Domain
PF00249 T[233-284] 3.1e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[231-287] 1.5e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[227-291] 1.4e-19 Homeodomain-like
Homeodomain-like

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like124 2e-28
TF_10_2 GARPARR-B class100 1e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 84 2e-16
TF_1_2 MYB superfamilyLHY 78 2e-14

TOP