AGI ID: At5g25475

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g25475
MLPKNAIEKI QANVSKPCFW KSLSPGQTWK SKSMRIIPED FVRRTRGAFE HRVVFSVRWE
NSWQLWLERE KNELFMIEED WNEFVDDNHL GPNDNLFIKH DETMNLEVQI FKNNGVEIID
VPLGVEPETE PFHPTPKKPH KETTPASSFA SGSGCSANGG TNGRGKQRSS DVKNPERYLL
NPENPYFVQA VTKRNDVLYV SRPVVQSYRL KFGPVKSTIT YLLPGEKKEE GENRIYNGKP
CFSGWSVLCR RHNLNIGDSV VCELERSGGV VTAVRVHFVK KD
Length = 282 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g25475

>At5g25475 unknown protein
          Length = 282

 Score = 82.3 bits (202), Expect = 8e-16
 Identities = 16/107 (14%), Positives = 33/107 (29%), Gaps = 8/107 (7%)

Query: 568 RFLLQKVLKQSDV-GNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFW 626
           +    K L       +    ++P+          E R      +  +     W +     
Sbjct: 16  KPCFWKSLSPGQTWKSKSMRIIPEDFVRRTRGAFEHR-----VVFSVRWENSWQLWL--E 68

Query: 627 PNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSG 673
                   + E+  +FV  N L   D + I  D  +   V++ + +G
Sbjct: 69  REKNELFMIEEDWNEFVDDNHLGPNDNLFIKHDETMNLEVQIFKNNG 115


InterPro Results:

NULL
seg ?[126-145]?[146-163] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 82 8e-16

TOP