AGI ID: At5g25465

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g25465
MLPRNATDKI QGNVSKPCFW KSLSPGQNWK SKSMRSFPEE FVKSTPGAFE HRVVFSVRWG
NSWQLWLERE EKDLFMIEED WDEFVDDNHL GPNDNVFFRH DDKMFLEVQI FKNDGNEIID
APPEVEPETE PFHPTTPKNS HKETTTASAS ASASEFSDNW RETHGCADIK NPELYLLNPK
NPYFVKTLTK GNDVLYVPKT VIKKYGLKFG PHLSPMHYLL PGDKINGSTK IYGGGSAPCF
NGWVDLCRKY NLKTGDSMVC ELERSGELVT AVRVHFINKT
Length = 280 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g25465

>At5g25465 unknown protein
          Length = 280

 Score = 76.5 bits (187), Expect = 5e-14
 Identities = 17/112 (15%), Positives = 34/112 (30%), Gaps = 10/112 (8%)

Query: 568 RFLLQKVLKQSDV-GNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFW 626
           +    K L       +      P++  ++     E R      +  +     W +     
Sbjct: 16  KPCFWKSLSPGQNWKSKSMRSFPEEFVKSTPGAFEHR-----VVFSVRWGNSWQLWL--E 68

Query: 627 PNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEA 678
              K    + E+  +FV  N L   D +    D K+   V++ +      E 
Sbjct: 69  REEKDLFMIEEDWDEFVDDNHLGPNDNVFFRHDDKMFLEVQIFKN--DGNEI 118


InterPro Results:

NULL
seg ?[122-137]?[144-154] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 76 5e-14

TOP