AGI ID: At5g24050

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g24050
MTSIYHDDDD HLTASGKDLW SNFCVLVDAA VMLYEEEEEE QRRKIVSEEE EEFQKRIFCL
FPRKTRSSLV KRQQNLIRVS TSSSLIDLNQ FPTDSEIEDP QNHLQGLSSS CFIAANSETK
TLQNPSSEPC SSLGLFGHKT AEYQKTETKD PPNPNFPCTM SLCLMENTSR KRRAVEQRKR
SGGVKKANVA PFSQTARETP EWLVKVMTNM KEAKDAKLIF EKTLFVTDVN PTKNRLSMPF
NNLLRNDFLT SVESIIINED INNNNKIGVG AILVDQRCKK WGVMLKRWEM KKESGKGSWS
YNLICGWNDI VEANRLKEGD NITLWSFRCC GILCFAMEQS SSSLALCLC
Length = 349 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At5g24050

>At5g24050 unknown protein
          Length = 349

 Score =  126 bits (316), Expect = 1e-28
 Identities = 29/186 (15%), Positives = 55/186 (28%), Gaps = 27/186 (14%)

Query: 66  PSYPNLP-SKLICMLHNVTLNADP-ETDEVYA---QMTLQP---VNKYDRDALLASDMGL 117
           P  PN P +  +C++ N +      E  +      +  + P     +   + L+     +
Sbjct: 151 PPNPNFPCTMSLCLMENTSRKRRAVEQRKRSGGVKKANVAPFSQTARETPEWLVKVMTNM 210

Query: 118 KLNRQPNEFFCKTLTASDTS-THGGFSVPRRAAEK--IFPALDF--------SMQPPCQE 166
           K  +     F KTL  +D + T    S+P     +     +++         +       
Sbjct: 211 KEAKDAKLIFEKTLFVTDVNPTKNRLSMPFNNLLRNDFLTSVESIIINEDINNNNKIGVG 270

Query: 167 LVAKDIHDNTWTFRHIYRGQ-------PKRHLLTTGWSVFVSTKRLFAGDSVLFIRDG-K 218
            +  D     W                   + L  GW+  V   RL  GD++        
Sbjct: 271 AILVDQRCKKWGVMLKRWEMKKESGKGSWSYNLICGWNDIVEANRLKEGDNITLWSFRCC 330

Query: 219 AQLLLG 224
             L   
Sbjct: 331 GILCFA 336


InterPro Results:

IPR005508 Domain
PF03754 T[197-313] 1.2e-77 DUF313
Protein of unknown function DUF313
NULL
coil ?[31-57] coiled-coil
seg ?[35-52]?[255-267] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7126 1e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3119 7e-27
TF_22_1 ABI3/VP1FUSCA3108 5e-24

TOP