AGI ID: At5g20730

TF ID:TF_17_2
Super family:ARF
Sub family:NPH4/ARF7
Gene name: auxin response factor 7 (ARF7)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
721
781
841
901
961
1021
1081
1141
>At5g20730
MKAPSSNGVS PNPVEGERRN INSELWHACA GPLISLPPAG SLVVYFPQGH SEQVAASMQK
QTDFIPSYPN LPSKLICMLH NVTLNADPET DEVYAQMTLQ PVNKYDRDAL LASDMGLKLN
RQPNEFFCKT LTASDTSTHG GFSVPRRAAE KIFPALDFSM QPPCQELVAK DIHDNTWTFR
HIYRGQPKRH LLTTGWSVFV STKRLFAGDS VLFIRDGKAQ LLLGIRRANR QQPALSSSVI
SSDSMHIGVL AAAAHANANN SPFTIFYNPR AAPAEFVVPL AKYTKAMYAQ VSLGMRFRMI
FETEECGVRR YMGTVTGISD LDPVRWKNSQ WRNLQIGWDE SAAGDRPSRV SVWDIEPVLT
PFYICPPPFF RPRFSGQPGM PDDETDMESA LKRAMPWLDN SLEMKDPSST IFPGLSLVQW
MNMQQQNGQL PSAAAQPGFF PSMLSPTAAL HNNLGGTDDP SKLLSFQTPH GGISSSNLQF
NKQNQQAPMS QLPQPPTTLS QQQQLQQLLH SSLNHQQQQS QSQQQQQQQQ LLQQQQQLQS
QQHSNNNQSQ SQQQQQLLQQ QQQQQLQQQH QQPLQQQTQQ QQLRTQPLQS HSHPQPQQLQ
QHKLQQLQVP QNQLYNGQQA AQQHQSQQAS THHLQPQLVS GSMASSVITP PSSSLNQSFQ
QQQQQSKQLQ QAHHHLGAST SQSSVIETSK SSSNLMSAPP QETQFSRQVE QQQPPGLNGQ
NQQTLLQQKA HQAQAQQIFQ QSLLEQPHIQ FQLLQRLQQQ QQQQFLSPQS QLPHHQLQSQ
QLQQLPTLSQ GHQFPSSCTN NGLSTLQPPQ MLVSRPQEKQ NPPVGGGVKA YSGITDGGDA
PSSSTSPSTN NCQISSSGFL NRSQSGPAIL IPDAAIDMSG NLVQDLYSKS DMRLKQELVG
QQKSKASLTD HQLEASASGT SYGLDGGENN RQQNFLAPTF GLDGDSRNSL LGGANVDNGF
VPDTLLSRGY DSQKDLQNML SNYGGVTNDI GTEMSTSAVR TQSFGVPNVP AISNDLAVND
AGVLGGGLWP AQTQRMRTYT KVQKRGSVGR SIDVNRYRGY DELRHDLARM FGIEGQLEDP
QTSDWKLVYV DHENDILLVG DDPWEEFVNC VQSIKILSSA EVQQMSLDGN FAGVPVTNQA
CSGGDSGNAW RGHYDDNSAT SFNR
Length = 1164 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_2
Sbjct: At5g20730

>At5g20730 auxin response factor 7 (ARF7)
          Length = 1164

 Score =  714 bits (1844), Expect = 0.0
 Identities = 470/490 (95%), Positives = 470/490 (95%), Gaps = 1/490 (0%)

Query: 1   MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQK 60
           MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQK
Sbjct: 1   MKAPSSNGVSPNPVEGERRNINSELWHACAGPLISLPPAGSLVVYFPQGHSEQVAASMQK 60

Query: 61  QTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLN 120
           QTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLN
Sbjct: 61  QTDFIPSYPNLPSKLICMLHNVTLNADPETDEVYAQMTLQPVNKYDRDALLASDMGLKLN 120

Query: 121 RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFR 180
           RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFR
Sbjct: 121 RQPNEFFCKTLTASDTSTHGGFSVPRRAAEKIFPALDFSMQPPCQELVAKDIHDNTWTFR 180

Query: 181 HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALXXXXX 240
           HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPAL     
Sbjct: 181 HIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDGKAQLLLGIRRANRQQPALSSSVI 240

Query: 241 XXXXMHIGVLXXXXXXXXXXSPFTIFYNPRWAAPAEFVVPLAKYTKAMYAQVSLGMRFRM 300
               MHIGVL          SPFTIFYNPR AAPAEFVVPLAKYTKAMYAQVSLGMRFRM
Sbjct: 241 SSDSMHIGVLAAAAHANANNSPFTIFYNPR-AAPAEFVVPLAKYTKAMYAQVSLGMRFRM 299

Query: 301 IFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVL 360
           IFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVL
Sbjct: 300 IFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQIGWDESAAGDRPSRVSVWDIEPVL 359

Query: 361 TPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQ 420
           TPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQ
Sbjct: 360 TPFYICPPPFFRPRFSGQPGMPDDETDMESALKRAMPWLDNSLEMKDPSSTIFPGLSLVQ 419

Query: 421 WMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQ 480
           WMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQ
Sbjct: 420 WMNMQQQNGQLPSAAAQPGFFPSMLSPTAALHNNLGGTDDPSKLLSFQTPHGGISSSNLQ 479

Query: 481 FNKQNQQAPM 490
           FNKQNQQAPM
Sbjct: 480 FNKQNQQAPM 489



 Score =  566 bits (1459), Expect = e-161
 Identities = 421/529 (79%), Positives = 421/529 (79%)

Query: 637  PQLVSGSMASSVITPPXXXXXXXXXXXXXXXXXXXXAHHHLGASTSQSSVIETSKSSSNL 696
            PQLVSGSMASSVITPP                    AHHHLGASTSQSSVIETSKSSSNL
Sbjct: 636  PQLVSGSMASSVITPPSSSLNQSFQQQQQQSKQLQQAHHHLGASTSQSSVIETSKSSSNL 695

Query: 697  MSAPPQETQFSRQVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHIXXXXXX 756
            MSAPPQETQFSRQVE                                    PHI      
Sbjct: 696  MSAPPQETQFSRQVEQQQPPGLNGQNQQTLLQQKAHQAQAQQIFQQSLLEQPHIQFQLLQ 755

Query: 757  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHQFPSSCTNNGLSTLQPPQMLVSR 816
                                               GHQFPSSCTNNGLSTLQPPQMLVSR
Sbjct: 756  RLQQQQQQQFLSPQSQLPHHQLQSQQLQQLPTLSQGHQFPSSCTNNGLSTLQPPQMLVSR 815

Query: 817  PQEKQNPPVGGGVKAYSGITDGGDAXXXXXXXXXXXCQISSSGFLNRSQSGPAILIPDAA 876
            PQEKQNPPVGGGVKAYSGITDGGDA           CQISSSGFLNRSQSGPAILIPDAA
Sbjct: 816  PQEKQNPPVGGGVKAYSGITDGGDAPSSSTSPSTNNCQISSSGFLNRSQSGPAILIPDAA 875

Query: 877  IDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNF 936
            IDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNF
Sbjct: 876  IDMSGNLVQDLYSKSDMRLKQELVGQQKSKASLTDHQLEASASGTSYGLDGGENNRQQNF 935

Query: 937  LAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMS 996
            LAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMS
Sbjct: 936  LAPTFGLDGDSRNSLLGGANVDNGFVPDTLLSRGYDSQKDLQNMLSNYGGVTNDIGTEMS 995

Query: 997  TSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVN 1056
            TSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVN
Sbjct: 996  TSAVRTQSFGVPNVPAISNDLAVNDAGVLGGGLWPAQTQRMRTYTKVQKRGSVGRSIDVN 1055

Query: 1057 RYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIK 1116
            RYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIK
Sbjct: 1056 RYRGYDELRHDLARMFGIEGQLEDPQTSDWKLVYVDHENDILLVGDDPWEEFVNCVQSIK 1115

Query: 1117 ILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR 1165
            ILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR
Sbjct: 1116 ILSSAEVQQMSLDGNFAGVPVTNQACSGGDSGNAWRGHYDDNSATSFNR 1164


InterPro Results:

IPR003340 Family
PF02362 T[126-231] 1e-20 B3
Transcriptional factor B3
IPR010525 Domain
PF06507 T[253-335] 3.1e-57 Auxin_resp
Auxin response factor
NULL
coil ?[515-542] coiled-coil
seg ?[236-244]?[251-260]?[490-635]?[652-671]?[711-746]?[750-790]?[841-851] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_2 ARFNPH4/ARF7714 0.0
TF_17_1 ARFMONOPTEROS/ARF5580 e-165
TF_17_3 ARFETTIN/ARF3505 e-143
TF_55 Aux/IAA158 3e-39
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3134 2e-31
TF_22_1 ABI3/VP1FUSCA3114 4e-26

TOP