AGI ID: At5g18240

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: transcription factor like protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g18240
MYYHNQHQGK SILSSSRMPI SSERHPFLRG NGTGDSGLIL STDAKPRLKW TPDLHERFVE
AVNQLGGGDK ATPKTIMKVM GIPGLTLYHL KSHLQKYRLS KNLNGQANSS LNKTSVMTMV
EENPPEVDES HSESLSIGPQ PSMNLPISDA LQMQIEVQRR LHEQLEVQRH LQLRIEAQGK
YLQSILEKAQ ETLGRQNLGA AGIEATKAQL SELVSKVSAD YPDSSFLEPK ELQNLHHQQM
QKTYPPNSSL DSCLTSSEGT QKAPKMLDNR LGLRTYIGDS TSEQKEIMEE PFFHRMELTW
AEEESLRENH NRPYLSTMVN NAEPRISSSR RSPGRLSIGV GLHEHRGRSS NNSEYTEERF
NENNEDCKLE THTRTALDLN THDENYGTTR PKQFDLNGFS WN
Length = 402 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g18240

>At5g18240 transcription factor like protein
          Length = 402

 Score =  115 bits (288), Expect = 9e-26
 Identities = 42/61 (68%), Positives = 51/61 (82%)

Query: 183 TGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLN 242
           +  AK RL+WTP+LH RFV AVN LGG DKATPK I+K+MG+ GLT+YH+KSHLQKYRL+
Sbjct: 41  STDAKPRLKWTPDLHERFVEAVNQLGGGDKATPKTIMKVMGIPGLTLYHLKSHLQKYRLS 100

Query: 243 I 243
            
Sbjct: 101 K 101



 Score = 94.7 bits (234), Expect = 2e-19
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGLT 430
           + +AL  Q+E+Q++LHEQLE QR LQL +EA G+Y+ S++E+   T
Sbjct: 147 ISDALQMQIEVQRRLHEQLEVQRHLQLRIEAQGKYLQSILEKAQET 192


InterPro Results:

IPR000905 Domain
PS01016 ?[74-94] NA GLYCOPROTEASE
Peptidase M22, glycoprotease
IPR001005 Domain
PF00249 T[47-98] 2.4e-12 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[45-101] 6.3e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[41-105] 3e-19 Homeodomain-like
Homeodomain-like
NULL
coil ?[148-169] coiled-coil
seg ?[11-22]?[324-339] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like115 9e-26
TF_10_2 GARPARR-B class 97 1e-21
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 83 4e-16
TF_1_2 MYB superfamilyLHY 78 2e-14

TOP