AGI ID: At5g18090

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g18090
MKNKAFGQIM DDAENPGFFK ILRSADLSSE IMRGIPLNFI KSISEEELSA KMLLKVSWGS
SWPIKICRNP SFYFMEKKGW DQFLSDNGLG NDEFLTFTHQ GNMCFTVDIY QIDGKELLTP
RRSATIASSS GRNKREQRNN IYKDVKEEED IESWSESSYP GHKTAESTGR RQRLSLSNKK
AKETEKSKKK KMKVESISYD SQDDSLSLVP EFTLTIKKSY LIFLGIPKMF EELHMPTEAT
MFKIHDPEGK RSWDVMYKFS NNQTRFCAGW IRLAKELGLE IGDVCTFTLI KPTEMLVRVS
K
Length = 301 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At5g18090

>At5g18090 unknown protein
          Length = 301

 Score = 88.4 bits (218), Expect = 4e-18
 Identities = 21/113 (18%), Positives = 38/113 (33%), Gaps = 11/113 (9%)

Query: 79  ARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHV 138
             + D   L   F   +K S +     + +PK   E H+P     E    ++ D +G   
Sbjct: 200 DSQDDSLSLVPEFTLTIKKSYL---IFLGIPKMFEELHMP----TEATMFKIHDPEGKRS 252

Query: 139 WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
           W   Y++  N                  GL++GD       +     +++  K
Sbjct: 253 WDVMYKFSNNQTRFC---AGWIRLAKELGLEIGDVCTF-TLIKPTEMLVRVSK 301


InterPro Results:

IPR003340 Family
PF02362 T[17-115] 2.2e-06T[211-301] 3.7e-05 B3
Transcriptional factor B3
NULL
seg ?[147-158]?[177-196] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 88 4e-18
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 82 1e-15

TOP