AGI ID: At5g18000

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g18000
MVKNKAFFGQ IMEERDNPAF FKILRREDHS TEMMRMIPHH LIRSISDKSS SFKMVLRVPW
GRSWQVKISK NPNFHYMEDR GWNQFVNDNG LGENEYLTFT HEANMCFNVT IFEADGTEML
RPRKTITSSS GRNKREERKS IYKDVKKEEE IESWSESSHP CHKTAESTSG RLTQKQELNL
RKKEADKTEK SKTSKKKKVE TVSNDSEAGT SSLIPEFKLT IKKSHLLFLG IPKKFVDMHM
PTETTMFKIH YPRGKKSWDV TYVVTDVQSR FSGGWSRLAK ELGLLVGDVC TFKLIKPTEM
RVKVSKE
Length = 307 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g18000

>At5g18000 putative protein
          Length = 307

 Score = 97.3 bits (241), Expect = 2e-20
 Identities = 20/133 (15%), Positives = 45/133 (33%), Gaps = 13/133 (9%)

Query: 564 EKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRY 623
           E+       K+L++ D       ++P     +   +  +       +  +   R W ++ 
Sbjct: 13  EERDNPAFFKILRREDHSTEMMRMIPHHLIRSISDKSSSFK----MVLRVPWGRSWQVKI 68

Query: 624 RFWPNNKSRMYLL-ENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPS-----GQKPE 677
                N +  Y+       FV  NGL E +++    +  +   V + +         +  
Sbjct: 69  SK---NPNFHYMEDRGWNQFVNDNGLGENEYLTFTHEANMCFNVTIFEADGTEMLRPRKT 125

Query: 678 APPSSAATKRQNK 690
              SS   KR+ +
Sbjct: 126 ITSSSGRNKREER 138



 Score = 65.3 bits (158), Expect = 1e-10
 Identities = 20/135 (14%), Positives = 40/135 (28%), Gaps = 10/135 (7%)

Query: 537 PTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETH 596
              D+   +    +++V            +L    +  +K+S +     + +PKK  + H
Sbjct: 183 KEADKTEKSKTSKKKKVETVSNDSEAGTSSLIPEFKLTIKKSHL---LFLGIPKKFVDMH 239

Query: 597 LPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVI 656
           +P     +     +      + W++ Y                    K  GL  GD    
Sbjct: 240 MP----TETTMFKIHYPRGKKSWDVTYVVTDVQSRF---SGGWSRLAKELGLLVGDVCTF 292

Query: 657 YSDVKLIRGVKVRQP 671
                    VKV + 
Sbjct: 293 KLIKPTEMRVKVSKE 307


InterPro Results:

IPR003340 Family
PF02362 T[19-117] 1.2e-06T[216-307] 1.1e-10 B3
Transcriptional factor B3
NULL
seg ?[148-158]?[182-203] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 97 2e-20
TF_22_1 ABI3/VP1FUSCA3 88 5e-18

TOP