AGI ID: At5g16560

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: KANADI protein (KAN)

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g16560
MSMEGVFLEK TKTNTTTTLP DLSLHISLPD IHQYHHNESS KESSRRSSQL ENNNRSSNFE
LSLSHHNHPT ARIFHCPDRR TLNLPHQQHY NNPIINGVHQ RVDESEISNL HRPIRGIPVY
HNRSFPFHQQ NSSLPSLGGG DMDQISILNS SSGYNNAYRS LQSSPRLKGV PLHHHHHHNQ
YGVVGSSDSS SPHHHNHHHH GMIRSRFLPK MPTKRSMRAP RMRWTSSLHA RFVHAVELLG
GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTNKP AASSDGSGEE EMGINGNEVH
HQSSTDQRAQ SDDTSLHQET DISSTQPRWS NSSRETWPLS NNCSSDIDTM IRTSSTSMIS
HYQRSSIQNQ EQRSNDQAKR CGNLSCENPS LEFTLGRPDW HEK
Length = 403 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g16560

>At5g16560 KANADI protein (KAN)
          Length = 403

 Score =  114 bits (286), Expect = 1e-25
 Identities = 33/67 (49%), Positives = 42/67 (62%)

Query: 175 FMQPQRAATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKS 234
           F+            R+RWT  LH RFV+AV  LGG ++ATPK +L+LM V  LT+ H+KS
Sbjct: 207 FLPKMPTKRSMRAPRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKS 266

Query: 235 HLQKYRL 241
           HLQ YR 
Sbjct: 267 HLQMYRT 273


InterPro Results:

IPR001005 Domain
PF00249 T[221-272] 3.6e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[219-275] 6.4e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[215-279] 1.8e-17 Homeodomain-like
Homeodomain-like
NULL
seg ?[10-18]?[38-48]?[173-178]?[186-200]?[344-360] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like114 1e-25
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1109 6e-24
TF_10_2 GARPARR-B class 84 1e-17
TF_1_2 MYB superfamilyLHY 55 1e-07

TOP