AGI ID: At5g13330

TF ID:TF_68
Super family:ERF
Sub family:
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
>At5g13330
MVSALSRVIE NPTDPPVKQE LDKSDQHQPD QDQPRRRHYR GVRQRPWGKW AAEIRDPKKA
ARVWLGTFET AEEAALAYDR AALKFKGTKA KLNFPERVQG PTTTTTISHA PRGVSESMNS
PPPRPGPPST TTTSWPMTYN QDILQYAQLL TSNNEVDLSY YTSTLFSQPF STPSSSSSSS
QQTQQQQLQQ QQQQREEEEK NYGYNYYNYP RE
Length = 212 AA.

PSI BLAST Result:

Query: Query sequence of TF_68
Sbjct: At5g13330

>At5g13330 putative protein
          Length = 212

 Score =  127 bits (319), Expect = 4e-30
 Identities = 44/65 (67%), Positives = 50/65 (76%)

Query: 8  REVHYRGVRKRPWGRYAAEIRDPWKKTRVWLGTFDTPEEAALAYDGAARFLRGIKAKTNF 67
          R  HYRGVR+RPWG++AAEIRDP K  RVWLGTF+T EEAALAYD AA   +G KAK NF
Sbjct: 35 RRRHYRGVRQRPWGKWAAEIRDPKKAARVWLGTFETAEEAALAYDRAALKFKGTKAKLNF 94

Query: 68 PSPLS 72
          P  + 
Sbjct: 95 PERVQ 99


InterPro Results:

IPR001471 Domain
PD001423 T[45-98] 1e-10 sp_Q9M4Y9_MESCR_Q9M4Y9;
PR00367 T[39-50] 3.5e-13T[61-77] 3.5e-13 ETHRSPELEMNT
PF00847 T[37-100] 1.4e-42 AP2
SM00380 T[38-101] 2.6e-38 AP2
Pathogenesis-related transcriptional factor and ERF
NULL
coil ?[181-202] coiled-coil
seg ?[25-38]?[71-83]?[120-138]?[162-194]?[196-212] seg
SSF54171 T[37-98] 1.4e-24 DNA-binding domain
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_68 ERF127 4e-30
TF_67 Pti6124 4e-29
TF_2_4 AP2/EREBPCBF1119 1e-27
TF_2_2 AP2/EREBPAINTEGUMENTA120 3e-27
TF_2_3 AP2/EREBPAPETALA2119 3e-27
TF_66 Pti5101 2e-22
TF_2_5 AP2/EREBPDREB2A100 1e-21
TF_65 Pti4 96 1e-20
TF_2_1 AP2/EREBPABSCISIC ACID-INSENSITIVE4 96 3e-20

TOP