AGI ID: At5g09780

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At5g09780
MASNPDFLWC KEERKQESFF KVLKRSDMSS EDTRAIPYDF VINFSDNELS GDMKFRVQWG
NSWKVKISKN PRFYFMEKSG WEKFVIDNAL GDHEFLTFTH KGQMSFTVKI FNKDGKEMMQ
PPQSRASFAS SSRVKTEQDV KREEEVLVSS DSRSRGPTTA AETNRGGSYK RKLNFGKKKA
EETQTYKRTE RTQNSKRTER VVSKERVYAG EPSSSVAGFK IFISKSYIKS LAIPKPFGNY
MPKEKTRVKI HHPDGEKTWK VVFVVKERGQ IFSGGWKRLC KEYPVVFGDT CKFTLITPLE
LLLVVSKP
Length = 308 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At5g09780

>At5g09780 putative protein
          Length = 308

 Score = 94.6 bits (234), Expect = 2e-19
 Identities = 18/116 (15%), Positives = 36/116 (30%), Gaps = 10/116 (8%)

Query: 564 EKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRY 623
           E+  +    KVLK+SD+ +     +P              +        +     W ++ 
Sbjct: 12  EERKQESFFKVLKRSDMSSEDTRAIPYDFVINF----SDNELSGDMKFRVQWGNSWKVKI 67

Query: 624 RFWPNNKSRMYLLE-NTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQPSGQKPEA 678
                N    ++ +     FV  N L + +F+      K      V+  +    E 
Sbjct: 68  SK---NPRFYFMEKSGWEKFVIDNALGDHEFLTFT--HKGQMSFTVKIFNKDGKEM 118



 Score = 54.1 bits (129), Expect = 3e-07
 Identities = 15/136 (11%), Positives = 38/136 (27%), Gaps = 15/136 (11%)

Query: 537 PTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETH 596
              +R  ++    R       R       +     +  + +S + +   + +PK     +
Sbjct: 187 KRTERTQNSKRTERVVSKE--RVYAGEPSSSVAGFKIFISKSYIKS---LAIPKPF-GNY 240

Query: 597 LPELEARDGISLAMEDIGTSRVWNMRY-RFWPNNKSRMYLLENTGDFVKTNGLQEGDFIV 655
           +P+ + R    + +      + W + +                     K   +  GD   
Sbjct: 241 MPKEKTR----VKIHHPDGEKTWKVVFVVKERGQ----IFSGGWKRLCKEYPVVFGDTCK 292

Query: 656 IYSDVKLIRGVKVRQP 671
                 L   + V +P
Sbjct: 293 FTLITPLELLLVVSKP 308


InterPro Results:

IPR003340 Family
PF02362 T[18-116] 9.3e-06T[217-308] 8.7e-06 B3
Transcriptional factor B3

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 95 2e-19
TF_22_1 ABI3/VP1FUSCA3 70 2e-12

TOP