AGI ID: At5g07210

TF ID:TF_1_6
Super family:MYB superfamily
Sub family:CIRCADIAN CLOCK ASSOCIATED 1
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
>At5g07210
MASAQSFYNQ SSVLKINVMV VDDDHVFLDI MSRMLQHSKY RDPSVMEIAV IAVDDPKKAL
STLKIQRDNI DLIITDYYMP GMNGLQLKKQ ITQEFGNLPV LVMSSDTNKE EESLSCGAMG
FIPKPIHPTD LTKIYQFALS NKRNGKSTLS TEQNHKDADV SVPQQITLVP EQADVLKTKR
KNCSFKSDSR TVNSTNGSCV STDGSRKNRK RKPNGGPSDD GESMSQPAKK KKIQWTDSLH
DLFLQAIRHI GLDKAVPKKI LAFMSVPYLT RENVASHLQK YRIFLRRVAE QGLYSMLSDR
GIDSMFRQTH IKEPYFNYYT PSTSWYDTRL NNRSFYSKPV HGFGQSKLLS TTREPVCFNQ
MPYNYMNRSS TYEPHRIGSG SNLTLPIQSN LSFPNQPSQN EERRSFFEPP VMANKIAQTS
QVLGFGQLGP SAISGHNFNN NMTSRYGSLI PSQPGPSHFS YGMQSFLNNE NVTYNPQPPA
NATTQPNLDE LPQLENLNLY NDFGNTSELP YNISNFQFDD NKHQQGEADP TKFELPAAKF
STELNHEDDG DWTFVNINQG QSNGETSNTI ASPETNTPIL NINHNQNQGQ DVPEFNDWSF
LDPQELVDDD FMNSLFNNDM N
Length = 621 AA.

PSI BLAST Result:

Query: Query sequence of TF_1_6
Sbjct: At5g07210

>At5g07210 putative protein
          Length = 621

 Score =  118 bits (297), Expect = 7e-27
 Identities = 29/200 (14%), Positives = 50/200 (24%), Gaps = 19/200 (9%)

Query: 7   GEDLVIKTRK-PYTITKQRERWTEEEHNRFIEALRLYG---RAWQKIEEH--VATKTAVQ 60
                           K++ +WT+  H+ F++A+R  G      +KI     V   T   
Sbjct: 214 NGGPSDDGESMSQPAKKKKIQWTDSLHDLFLQAIRHIGLDKAVPKKILAFMSVPYLTREN 273

Query: 61  IRSHAQKFFSKVEKEAEAKGVAMGQALDIAIXXXXXXXXXXXXXXXXTGSG--TILMSKT 118
           + SH QK+   + + AE    +M     I                    +      ++  
Sbjct: 274 VASHLQKYRIFLRRVAEQGLYSMLSDRGIDSMFRQTHIKEPYFNYYTPSTSWYDTRLNNR 333

Query: 119 GVNDGKES---------LGSEKVSHPEMANEDRQQSKPEEKTLQEDNCSDCFTHQYLSAA 169
                               E V   +M      +                 T    S  
Sbjct: 334 SFYSKPVHGFGQSKLLSTTREPVCFNQMPYNYMNR--SSTYEPHRIGSGSNLTLPIQSNL 391

Query: 170 SSMNKSCIETSNASTFREFL 189
           S  N+        S F   +
Sbjct: 392 SFPNQPSQNEERRSFFEPPV 411


InterPro Results:

IPR001005 Domain
PF00249 T[232-282] 4.5e-07 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[16-131] 1e-60 sp_Q9LYP5_ARATH_Q9LYP5;
PF00072 T[16-143] 1.4e-22 Response_reg
SM00448 T[16-135] 9.3e-22 REC
PS50110 T[17-139] 24.658 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[230-285] 1.8e-33 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[226-289] 2.8e-18 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[15-157] 5.7e-24 CheY-like
CheY-like

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1118 7e-27
TF_10_2 GARPARR-B class 99 6e-22
TF_10_1 GARPG2-like 99 1e-20
TF_1_2 MYB superfamilyLHY 72 8e-13

TOP