AGI ID: At5g06800

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At5g06800
MDNINFEFSN ASQGSRLQLQ QQPPQPFNLQ DLNMIQYNQP SSPWTTETFS GLTPYDCTAN
QSFPVQCSSS KPYPSSFHPY HHQSSDSPSL DQSVSMIPMQ PLPDQYMKPL YQRSCSNDFA
ATNASSASYS LSFEASHDPQ ELCRRTYSNS NVTHLNFTSS QHQPKQSHPR FSSPPSFSIH
GGSMAPNCVN KTRIRWTQDL HEKFVECVNR LGGADKATPK AILKRMDSDG LTIFHVKSHL
QKYRIAKYMP ESQEGKFEKR ACAKELSQLD TRTGVQIKEA LQLQLDVQRH LHEQLEIQRN
LQLRIEEQGK QLKMMMEQQQ KNKESLLKKL PDAEASLSLL DPHIHSPPSP FLVHDAEALM
LTSYEDTQLQ STKS
Length = 374 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g06800

>At5g06800 putative protein
          Length = 374

 Score =  111 bits (277), Expect = 2e-24
 Identities = 39/60 (65%), Positives = 47/60 (78%)

Query: 187 KSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRLNIRLP 246
           K+R+RWT +LH +FV  VN LGG DKATPK ILK M  DGLTI+H+KSHLQKYR+   +P
Sbjct: 191 KTRIRWTQDLHEKFVECVNRLGGADKATPKAILKRMDSDGLTIFHVKSHLQKYRIAKYMP 250



 Score = 90.1 bits (222), Expect = 5e-18
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 5/56 (8%)

Query: 385 LEEALLFQMELQKKLHEQLETQRQLQLSLEAHGRYIASLMEQEGL-----TSRLPE 435
           ++EAL  Q+++Q+ LHEQLE QR LQL +E  G+ +  +MEQ+         +LP+
Sbjct: 277 IKEALQLQLDVQRHLHEQLEIQRNLQLRIEEQGKQLKMMMEQQQKNKESLLKKLPD 332


InterPro Results:

IPR001005 Domain
PF00249 T[193-244] 2.3e-09 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[191-247] 6.5e-27 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[187-251] 5.7e-18 Homeodomain-like
Homeodomain-like
NULL
coil ?[278-299]?[309-337] coiled-coil
seg ?[17-30]?[83-95]?[120-136]?[171-178]?[306-324] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like111 2e-24
TF_10_2 GARPARR-B class 91 8e-20
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 73 4e-13
TF_1_2 MYB superfamilyLHY 67 3e-11

TOP