AGI ID: At5g06250

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
>At5g06250
MSVNHYSTDH HHTLLWQQQQ HRHTTDTSET TTTATWLHDD LKESLFEKSL TPSDVGKLNR
LVIPKQHAEK YFPLNAVLVS SAAADTSSSE KGMLLSFEDE SGKSWRFRYS YWNSSQSYVL
TKGWSRFVKD KQLDPGDVVF FQRHRSDSRR LFIGWRRRGQ GSSSSVAATN SAVNTSSMGA
LSYHQIHATS NYSNPPSHSE YSHYGAAVAT AAETHSTPSS SVVGSSRTVR LFGVNLECQM
DENDGDDSVA VATTVESPDG YYGQNMYYYY SHPHNMVILT LL
Length = 282 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At5g06250

>At5g06250 putative protein
          Length = 282

 Score =  182 bits (463), Expect = 4e-46
 Identities = 50/168 (29%), Positives = 74/168 (43%), Gaps = 25/168 (14%)

Query: 155 TPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDY---------SQPRPSQELLARDLH 205
              +F K+LT SD        +P++ AE  FP             S       L   D  
Sbjct: 42  KESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDES 101

Query: 206 GLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGDDGKLRLGVRRASQI 263
           G  WRFR+ Y    + ++LT GWS FV  K+L  GD V F   R D  +L +G RR    
Sbjct: 102 GKSWRFRYSYWNSSQSYVLTKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRG-- 159

Query: 264 EGTAALSAQYNQNMNHNNFSEVAHAISTHSVFSISYNPKASWSNFIIP 311
           +G+++  A  N             A++T S+ ++SY+   + SN+  P
Sbjct: 160 QGSSSSVAATNS------------AVNTSSMGALSYHQIHATSNYSNP 195


InterPro Results:

IPR003340 Family
PF02362 T[45-161] 6.8e-20 B3
Transcriptional factor B3
NULL
seg ?[8-35]?[154-177]?[214-229]?[261-270] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3182 4e-46
TF_17_1 ARFMONOPTEROS/ARF5165 1e-40
TF_17_2 ARFNPH4/ARF7148 1e-35
TF_22_1 ABI3/VP1FUSCA3122 3e-28
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3118 1e-26

TOP