AGI ID: At5g05090

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
>At5g05090
MREEDSNWFA KWEEELPSPE ELIPLSQSLI TPDLAIAFDL HRNNNSNSGQ PLPQTTPPQP
NSSAEIAGDS TGDEPARTLK RPRLVWTPQL HKRFVDAVAH LGIKNAVPKT IMQLMSVDGL
TRENVASHLQ KYRLYLKRMK SGGGGGGSGD SDHLFASSPV PPHFLHPTSR QSSDLFIPSF
VPISTQQQHI AAPPSQFLHR QISAVNFTSP TKATDQAMFL ARQQSELQQP VFKPSSLHLH
SQVANYTQDL KSGAKTVLTL FPTRDD
Length = 266 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At5g05090

>At5g05090 unknown protein
          Length = 266

 Score =  109 bits (272), Expect = 7e-24
 Identities = 34/64 (53%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 182 ATGPAKSRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHIKSHLQKYRL 241
           A    + RL WTP+LH RFV+AV  LG  + A PK I++LM VDGLT  ++ SHLQKYRL
Sbjct: 76  ARTLKRPRLVWTPQLHKRFVDAVAHLGIKN-AVPKTIMQLMSVDGLTRENVASHLQKYRL 134

Query: 242 NIRL 245
            ++ 
Sbjct: 135 YLKR 138


InterPro Results:

IPR001005 Domain
PF00249 T[83-133] 1.6e-10 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[81-136] 1.2e-28 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[77-140] 1.7e-20 Homeodomain-like
Homeodomain-like
NULL
seg ?[13-29]?[50-60]?[141-152] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like109 7e-24
TF_10_2 GARPARR-B class101 8e-23
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 81 2e-15
TF_1_2 MYB superfamilyLHY 75 1e-13

TOP