AGI ID: At4g37180

TF ID:TF_10_1
Super family:GARP
Sub family:G2-like
Gene name: putative cytoskeletal protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g37180
MGLNLNLSIY SLPKPLSQFL DEVSRIKDNH SKLSEIDGYV GKLEEERNKI DVFKRELPLC
MLLLNEAIGA LKDEARKGLS LMASNGKFDD VERAKPETDK KSWMSSAQLW ISNPNSQFRS
TNEEEEDRCV SQNPFQTCNY PNQGGVFMPF NRPPPPPPPA PLSLMTPTSE MMMDYSRIEQ
SHHHHQFNKP SSQSHHIQKK EQRRRWSQEL HRKFVDALHR LGGPQVATPK QIRDLMKVDG
LTNDEVKSHL QKYRMHIRKH PLHPTKTLSS SDQPGVLERE SQSLISLSRS DSPQSPLVAR
GLFSSNVGHS SEEDEEEEDE EEEKSDGRSS CRNDETKKKR QVLDLEL
Length = 347 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_1
Sbjct: At4g37180

>At4g37180 putative cytoskeletal protein
          Length = 347

 Score =  116 bits (290), Expect = 5e-26
 Identities = 38/73 (52%), Positives = 48/73 (65%), Gaps = 2/73 (2%)

Query: 175 FMQPQRAATGPAK--SRLRWTPELHNRFVNAVNSLGGPDKATPKGILKLMGVDGLTIYHI 232
           F +P   +    K   R RW+ ELH +FV+A++ LGGP  ATPK I  LM VDGLT   +
Sbjct: 187 FNKPSSQSHHIQKKEQRRRWSQELHRKFVDALHRLGGPQVATPKQIRDLMKVDGLTNDEV 246

Query: 233 KSHLQKYRLNIRL 245
           KSHLQKYR++IR 
Sbjct: 247 KSHLQKYRMHIRK 259


InterPro Results:

IPR001005 Domain
PF00249 T[203-254] 8.9e-12 Myb_DNA-binding
Myb, DNA-binding
IPR006447 Domain
TIGR01557 T[201-257] 3.6e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[197-261] 3.8e-18 Homeodomain-like
Homeodomain-like
NULL
seg ?[153-161]?[277-297]?[312-323] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_1 GARPG2-like116 5e-26
TF_10_2 GARPARR-B class 89 3e-19
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 79 9e-15
TF_1_2 MYB superfamilyLHY 67 4e-11

TOP