AGI ID: At4g34400

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
>At4g34400
MASSMASNDF QLPPRFFTVF VSHFSSEFMV IPVSYYDHIP HRFPKTVILR GPGGCSWKVA
TEIKDDEVLF SQGWPKFVRD NTLNDGDFLT FAYNGAHIFE VSIFRGYDAC KEISEVTELE
EEEEDSVISL SSEDTDTGAK SEMKNTVPEG RDKGKSKVEV VEDSDDDEEE DSVYSESSEE
TETDTDSEFK VAKPTIPKSQ KKGKKKEQVV ESSDDEEDEE EDSDSDYIET FGQLDIEENS
ISEEDSSYAP DKEDTATASF VKPKVANKVA NLKRKVDPMI KNPERYLDDP KNIHFETNVK
NRLYELLVHA QLVKDYCLRF GDYVNYIDRF GKLSAKTAKW KDQRVCIKRW MRICKRNKLK
KEDRILCELL RKGTFVYAIK LHVIRGKDL
Length = 389 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At4g34400

>At4g34400 putative protein
          Length = 389

 Score = 74.6 bits (182), Expect = 2e-13
 Identities = 14/117 (11%), Positives = 30/117 (24%), Gaps = 17/117 (14%)

Query: 557 RRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLP---KKEAETHLPELEARDGISLAMEDI 613
                   +         +  S   +    V+P           P+          +   
Sbjct: 3   SSMASNDFQLPPRFF--TVFVSHFSSEFM-VIPVSYYDHIPHRFPK--------TVILRG 51

Query: 614 GTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGVKVRQ 670
                W +      +    +   +    FV+ N L +GDF+    +   I  V + +
Sbjct: 52  PGGCSWKVATEIKDDE---VLFSQGWPKFVRDNTLNDGDFLTFAYNGAHIFEVSIFR 105


InterPro Results:

NULL
seg ?[112-134]?[158-188]?[198-226]?[235-247] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 75 2e-13

TOP