AGI ID: At4g33280

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: hypothetical protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At4g33280
MEENCEDCMK WEEELYWTHF QTLHFTQLLL PGFHNRLQFM LLFQFLHVFT FLCFPPAFNL
EIYTQMYQRG LSNFCFFLSK SVLCGFKSPK IANSSIKITT FCNLLQVIPR KFSTHCKRKL
PQIVTLKSPS GVTYNVGVEE DDEKTMAFRF GWDKFVKDHS LEENDLLVFK FHGVSEFEVL
VFDGQTLCEK PTSYFVRKCG HAEKTKGIID FNATSSRSPK RHFNPDDVET TPNQQLVISP
PVDNELEDLI DIDLDFDIDK ILNPLLVASH TGYEQEEHIN SDIDTASAQL PVISPTSTVR
VSEGKYPLSG FKKMRRELSN DNLDQKAAGS NKKALSLAKR AISPDGFLVF MKRSHVVSKC
FLTIPYKWCV KNMLITRQEV VMQVDQTKWE MKFNIFGARG SGGISTGWKK FVQDNNLREG
DVCVFEPANS ETKPLHLNVY IFRGEETERT NNVDPVYTIS E
Length = 461 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At4g33280

>At4g33280 hypothetical protein
          Length = 461

 Score = 70.3 bits (171), Expect = 3e-12
 Identities = 21/109 (19%), Positives = 40/109 (36%), Gaps = 9/109 (8%)

Query: 571 LQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNK 630
               +K+S V +   + +P K    ++          + M+   T   W M++  +    
Sbjct: 347 FLVFMKRSHVVSKCFLTIPYKWCVKNM----LITRQEVVMQVDQT--KWEMKFNIFGARG 400

Query: 631 SRMYLLENTGDFVKTNGLQEGDFIVIY--SDVKLIRGVKVRQPSGQKPE 677
           S   +      FV+ N L+EGD  V    +       + V    G++ E
Sbjct: 401 SG-GISTGWKKFVQDNNLREGDVCVFEPANSETKPLHLNVYIFRGEETE 448



 Score = 53.8 bits (128), Expect = 4e-07
 Identities = 15/83 (18%), Positives = 25/83 (30%), Gaps = 7/83 (8%)

Query: 587 VLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTN 646
           V+P+K +         R    +      +   +N+           M        FVK +
Sbjct: 107 VIPRKFSTHC-----KRKLPQIVTLKSPSGVTYNVGVEEDDEKT--MAFRFGWDKFVKDH 159

Query: 647 GLQEGDFIVIYSDVKLIRGVKVR 669
            L+E D +V          V V 
Sbjct: 160 SLEENDLLVFKFHGVSEFEVLVF 182


InterPro Results:

IPR003340 Family
PF02362 T[94-194] 0.00064T[347-447] 2.4e-05 B3
Transcriptional factor B3
NULL
seg ?[243-263] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 70 3e-12

TOP