AGI ID: At4g32010

TF ID:TF_17_3
Super family:ARF
Sub family:ETTIN/ARF3
Gene name: predicted protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
601
661
>At4g32010
MEVTRGFSFL DKFLRKRLHC GCIASRFMME LLENGGVTCI SCAKKSGLIS MNVSHESNGK
DFPSFASAEH VGSVLERTNL KHLLHFQRID PTHSSLQMKQ EESLLPSSLD ALRHKTERKE
LSAQPNLSIS LGPTLMTSPF HDAAVDDRSK TNSIFQLAPR SRQLLPKPAN SAPIAAGMEP
SGSLVSQIHV ARPPPEGRGK TQLLPRYWPR ITDQELLQLS GQYPHLYESL TVYFPSSNSK
IIPLFEKVLS ASDAGRIGRL VLPKACAEAY FPPISLPEGL PLKIQDIKGK EWVFQFRFWP
NNNSRMYVLE GVTPCIQSMQ LQAGDTVTFS RTEPEGKLVM GYRKATNSTA TQMFKGSSEP
NLNMFSNSLN PGCGDINWSK LEKSEDMAKD NLFLQSSLTS ARKRVRNIGT KSKRLLIDSV
DVLELKITWE EAQELLRPPQ STKPSIFTLE NQDFEEYDKL PSLHNETFVS TEFKRRRLAS
SNEKLNQSQD ASALNSLGNA GITTTGEQGE ITVAATTKHP RHRAGCSCIV CSQPPSGKGK
HKPSCTCTVC EAVKRRFRTL MLRKRNKGEA GQASQQAQSQ SECRDETEVE SIPAVELAAG
ENIDLNSDPG ASRVSMMRLL QAAAFPLEAY LKQKAISNTA GEQQSSDMVS TEHGSSSAAQ
ETEKDTTNGA HDPVN
Length = 675 AA.

PSI BLAST Result:

Query: Query sequence of TF_17_3
Sbjct: At4g32010

>At4g32010 predicted protein
          Length = 675

 Score =  150 bits (379), Expect = 3e-36
 Identities = 39/155 (25%), Positives = 64/155 (41%), Gaps = 5/155 (3%)

Query: 126 SEDIERKVREGIIDVDGGEEDYEVLKRSNTPHMFCKTLTASDTSTHGGFSVPRRAAEDCF 185
           ++    ++      +      Y     S    +F K L+ASD    G   +P+  AE  F
Sbjct: 212 TDQELLQLSGQYPHLYESLTVYFPSSNSKIIPLFEKVLSASDAGRIGRLVLPKACAEAYF 271

Query: 186 PPLDYSQPRPSQELLARDLHGLEWRFRHIYR-GQPRRHLLTTGWSAFVNKKKLVSGDAVL 244
           PP+   +  P   L  +D+ G EW F+  +      R  +  G +  +   +L +GD V 
Sbjct: 272 PPISLPEGLP---LKIQDIKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQSMQLQAGDTVT 328

Query: 245 FLRG-DDGKLRLGVRRASQIEGTAALSAQYNQNMN 278
           F R   +GKL +G R+A+    T         N+N
Sbjct: 329 FSRTEPEGKLVMGYRKATNSTATQMFKGSSEPNLN 363


InterPro Results:

IPR003340 Family
PF02362 T[244-348] 1.4e-18 B3
Transcriptional factor B3
NULL
seg ?[501-512]?[568-582] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_17_3 ARFETTIN/ARF3150 3e-36
TF_17_1 ARFMONOPTEROS/ARF5139 6e-33
TF_17_2 ARFNPH4/ARF7125 2e-28
TF_22_1 ABI3/VP1FUSCA3120 1e-27
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3111 2e-24

TOP