AGI ID: At4g31920

TF ID:TF_10_2
Super family:GARP
Sub family:ARR-B class
Gene name: predicted protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
541
>At4g31920
MTMEQEIEVL DQFPVGMRVL AVDDDQTCLR ILQTLLQRCQ YHVTTTNQAQ TALELLRENK
NKFDLVISDV DMPDMDGFKL LELVGLEMDL PVIMLSAHSD PKYVMKGVKH GACDYLLKPV
RIEELKNIWQ HVVRKSKLKK NKSNVSNGSG NCDKANRKRK EQYEEEEEEE RGNDNDDPTA
QKKPRVLWTH ELHNKFLAAV DHLGVERAVP KKILDLMNVD KLTRENVASH LQKFRVALKK
VSDDAIQQAN RAAIDSHFMQ MNSQKGLGGF YHHHRGIPVG SGQFHGGTTM MRHYSSNRNL
GRLNSLGAGM FQPVSSSFPR NHNDGGNILQ GLPLEELQIN NNINRAFPSF TSQQNSPMVA
PSNLLLLEGN PQSSSLPSNP GFSPHFEISK RLEHWSNAAL STNIPQSDVH SKPDTLEWNA
FCDSASPLVN PNLDTNPASL CRNTGFGSTN AAQTDFFYPL QMNQQPANNS GPVTEAQLFR
SSNPNEGLLM GQQKLQSGLM ASDAGSLDDI VNSLMTQEQS QSDFSEGDWD LDGLAHSEHA
YEKLHFPFSL SA
Length = 552 AA.

PSI BLAST Result:

Query: Query sequence of TF_10_2
Sbjct: At4g31920

>At4g31920 predicted protein
          Length = 552

 Score =  101 bits (252), Expect = 9e-23
 Identities = 41/60 (68%), Positives = 53/60 (88%)

Query: 1   KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLG 60
           KPRV+W+ ELH +F+AAV+ LGVE+AVPKKIL+LMNV  LTRENVASHLQK+R+ L+++ 
Sbjct: 183 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKKVS 242


InterPro Results:

IPR001005 Domain
PF00249 T[185-235] 6.7e-09 Myb_DNA-binding
Myb, DNA-binding
IPR001789 Domain
PD000039 T[17-125] 1e-56 sp_O49397_ARATH_O49397;
PF00072 T[17-137] 3.5e-31 Response_reg
SM00448 T[17-129] 1.1e-34 REC
PS50110 T[18-133] 33.714 RESPONSE_REGULATORY
Response regulator receiver
IPR006447 Domain
TIGR01557 T[183-238] 2.7e-30 myb_SHAQKYF
Myb-like DNA-binding region, SHAQKYF class
IPR009057 Domain
SSF46689 T[179-242] 4.6e-20 Homeodomain-like
Homeodomain-like
IPR011006 Domain
SSF52172 T[16-151] 4.9e-34 CheY-like
CheY-like
NULL
seg ?[135-151]?[164-170] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_10_2 GARPARR-B class101 9e-23
TF_10_1 GARPG2-like103 4e-22
TF_1_6 MYB superfamilyCIRCADIAN CLOCK ASSOCIATED 1 69 6e-12
TF_1_2 MYB superfamilyLHY 61 2e-09

TOP