AGI ID: At4g31690

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At4g31690
MANASPLSPT NQHFFQPLLP GFQSNLKIPV NYFSEHIEGK HEGKTVTLRT DASERTWEVK
MEGHRLTEGW KEFVEAHDLR IGDFVVFRHE GDMVFHVTAL GPSCCEIQYP QSSRHEEGEE
SGENEISEKE GEENVQKESD KSSSDLNCFS QSVTHSNISR DAVSVPRDFV KRSGFSKGRH
EIVLMNEEGK SWESEVKSYM SGAVYLVGGW TTFCTENKLD VGDSCTFKLL QKAKTPVFQL
CSRTKHLPLS FTKVNGLINP GKIILVDKDR AEWSMMLKVD SRGAVYIIGG NDWKSFCAAN
EVGAGESLAL ELIQGGVLLN QITTCFQMEQ PSFKAEDGRH KRARVQNRSQ ETDKGAETSR
ASTMGPKLEI TEKGEPSRAS TMRPKVEIRE KIAETGEPSR ASNKSSGIEG NLQHTKPCSV
KTDQLAKVKE SVVDTLTSIG RFQAELETMK RKLEDSLQEL N
Length = 461 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31690

>At4g31690 putative protein
          Length = 461

 Score =  108 bits (270), Expect = 4e-24
 Identities = 13/110 (11%), Positives = 35/110 (31%), Gaps = 7/110 (6%)

Query: 84  PRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKY 143
                  F + + +S++S    + +P+   +         +G    +   +    W  + 
Sbjct: 142 SSSDLNCFSQSVTHSNISRDA-VSVPRDFVKR----SGFSKGRHEIVLMNEEGKSWESEV 196

Query: 144 RYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKAS 193
           +     +  +Y++     F   + L +GD         +   V Q    +
Sbjct: 197 K--SYMSGAVYLVGGWTTFCTENKLDVGDSCTFKLLQKAKTPVFQLCSRT 244



 Score = 42.2 bits (98), Expect = 4e-04
 Identities = 16/87 (18%), Positives = 29/87 (32%), Gaps = 12/87 (13%)

Query: 103 LRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDF 162
              + +P      H+      EG  + +        W  K            + E   +F
Sbjct: 23  QSNLKIPVNYFSEHI--EGKHEGKTVTLRTDASERTWEVKMEGHR-------LTEGWKEF 73

Query: 163 VNAHGLQLGDFIMVYQDLYSNNYVIQA 189
           V AH L++GDF++     +  + V   
Sbjct: 74  VEAHDLRIGDFVVF---RHEGDMVFHV 97


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 4.4e-33T[148-246] 7.6e-33T[247-327] 4.8e-05 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[55-113] 3.3e-09 Cupredoxins
Cupredoxin
NULL
coil ?[439-460] coiled-coil
seg ?[116-134] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3108 4e-24
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 94 3e-19
TF_17_2 ARFNPH4/ARF7 50 6e-06

TOP