AGI ID: At4g31680

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At4g31680
MANASQLSPT NKHFFKPLLP GFQRNLSHGS VSLLQNIPVK FFSEHIEGKH EGETVKLRAD
ASKRTWEVKM DGNRLTEGWK EFVEAHDLRI RDFVVFRHEG DMVFHVTALG PSCCEIQYPQ
SISHEEGEES GEVGMIESSF KISEREVEEN LQKEYDQSSA DLNCFSQSVT HSNISNDLVT
LPRDFAKRNG LDKGMHEIVL MNEEGKSWES EVRSRMSGQV FIVGGWKSLC SENKLKGGDS
CTFKLLQNAK TPVFQLCSRI GESRFVKLTP TLNSLEIGKQ HLPVSFTKGN GLIHPGEIIL
VDKDRVEWSM KLQVDNRGGM HIFGGNDWKS FCAANEVGAG ESLTLELIRG GLSPLFKFFS
KIEQPSFEAE DRRHKRARVH NGSQETDKGE PSRATKMGPE LEKREKTAEK GEPSRASNKS
SGKQGNLQKT QACSVTDHVA KVKESVVDTL TSIRRFQAEL ETMEQKLEDS LQEINKLS
Length = 478 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31680

>At4g31680 putative protein
          Length = 478

 Score =  107 bits (267), Expect = 1e-23
 Identities = 15/114 (13%), Positives = 41/114 (35%), Gaps = 8/114 (7%)

Query: 80  RKIDPRK-LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHV 138
           ++ D        F + + +S++S+   + LP+  A+         +G+   +   +    
Sbjct: 153 KEYDQSSADLNCFSQSVTHSNISNDL-VTLPRDFAKR----NGLDKGMHEIVLMNEEGKS 207

Query: 139 WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKA 192
           W  + R     + +++++       + + L+ GD         +   V Q    
Sbjct: 208 WESEVRSR--MSGQVFIVGGWKSLCSENKLKGGDSCTFKLLQNAKTPVFQLCSR 259


InterPro Results:

IPR003340 Family
PF02362 T[21-114] 2.7e-31T[164-263] 5.6e-42T[267-365] 6.1e-16 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[64-124] 3.5e-08 Cupredoxins
Cupredoxin
NULL
coil ?[453-478] coiled-coil
seg ?[121-139] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3107 1e-23
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 97 4e-20
TF_17_2 ARFNPH4/ARF7 55 3e-07

TOP