AGI ID: At4g31660

TF ID:TF_22_2
Super family:ABI3/VP1
Sub family:ABSCISIC ACID-INSENSITIVE3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g31660
MADPVLQSPK NSHFFQPLLP GFDSYLNIPV KFFSKRIQGR NEGRTVELRT DASEKTWQVK
IQGRRLTVGW KEFASAHDFR VGDIIVFRHE GSLVFHVTAL GPSCCEIQYV PSCNNQENIS
NLSMKQSIKT ELESSLDEDK VNMGKFPRKK HVKKRIPEAE AKSFSSDKSC FVAHVTDSNL
REDTLFLPRK FDRSDGLIKG SNKIVLMNEE ARTWTLILKF RNSKLKSVST KDFNKIKRKE
SGDSSQKVPS SSSSVSEYRF LTLTVTPAAL KDGRLRVPIK FIKGNRMENL GMKKITLLDK
HGVEWPVNLV MYKGNTQTRF GSGLKEFFKA NGIEACKSFV LELV
Length = 344 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_2
Sbjct: At4g31660

>At4g31660 putative protein
          Length = 344

 Score = 74.9 bits (183), Expect = 1e-13
 Identities = 17/121 (14%), Positives = 36/121 (29%), Gaps = 9/121 (7%)

Query: 532 METQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKK 591
           +E+ L             +           K   + +      +  S++     + LP+K
Sbjct: 132 LESSLDEDKVNMGKFPRKKHVKKRIPEAEAKSFSSDKSCFVAHVTDSNLREDT-LFLPRK 190

Query: 592 EAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEG 651
              +         G +  +     +R W +  +F  +    +     T DF K    + G
Sbjct: 191 FDRS----DGLIKGSNKIVLMNEEARTWTLILKFRNSKLKSVS----TKDFNKIKRKESG 242

Query: 652 D 652
           D
Sbjct: 243 D 243



 Score = 53.8 bits (128), Expect = 4e-07
 Identities = 15/103 (14%), Positives = 29/103 (27%), Gaps = 14/103 (13%)

Query: 565 KNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAMED-IGTSRVWNMRY 623
                   + L       L    +P K        ++ R+           + + W ++ 
Sbjct: 8   SPKNSHFFQPLLPGFDSYLN---IPVKF---FSKRIQGRNEGRTVELRTDASEKTWQVKI 61

Query: 624 RFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKLIRGV 666
                   R  L     +F   +  + GD IV   +  L+  V
Sbjct: 62  -----QGRR--LTVGWKEFASAHDFRVGDIIVFRHEGSLVFHV 97



 Score = 48.0 bits (113), Expect = 2e-05
 Identities = 17/145 (11%), Positives = 38/145 (25%), Gaps = 28/145 (19%)

Query: 535 QLPTMDRAGS------ASAMPRQQVVPDRRQGWKPEKNL-------------RFLLQKVL 575
            +    R  +       S +         +   K   +                 L   +
Sbjct: 206 LMNEEARTWTLILKFRNSKLKSVSTKDFNKIKRKESGDSSQKVPSSSSSVSEYRFLTLTV 265

Query: 576 KQSDVGNLGRIVLPKKEAE-THLPELEARDGISLAMEDIGTSRVWNMRY-RFWPNNKSRM 633
             + +   GR+ +P K  +   +  L  +               W +    +  N ++R 
Sbjct: 266 TPAAL-KDGRLRVPIKFIKGNRMENLGMKK----ITLLDKHGVEWPVNLVMYKGNTQTR- 319

Query: 634 YLLENTGDFVKTNGLQEGDFIVIYS 658
                  +F K NG++     V+  
Sbjct: 320 -FGSGLKEFFKANGIEACKSFVLEL 343


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 5.5e-31T[170-258] 5e-09T[260-344] 0.0034 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[55-130] 9.2e-12 Cupredoxins
Cupredoxin
NULL
seg ?[241-256] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 75 1e-13
TF_22_1 ABI3/VP1FUSCA3 69 4e-12
TF_17_2 ARFNPH4/ARF7 53 7e-07

TOP