AGI ID: At4g31650

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g31650
MNNPTLFSPK SPHFFQPLLP GFKSHINIPV KFFSKYIKGK HEGKTVKLRS DSSKRTWKVK
IEGHTLTDGW KEFVEAHDLR ISDFVIFKHK GDMFFDVTAL GSSCWESSRK EKEIEENIET
EPDQFSSDLT CFSQSVTTSN LMRDSVGVPR DFAKRYGFNI GRHEIVLMNE EGKPWESEVI
SYKSGKVIVA GGWKSLCTES KLEVGDSCTF KLLHNAKMPV FRLCSKLPKA GAEARPLKRA
RVQRWSQESR SKHDVREKIA EEGEPSRRNR TSNKSTGDQG KLQQTQSCFI FDHVAKSLPR
NFVRSDGLIK GSNKIVLMNE GARTWTLILK FRDSRRSFYS RGGWRSFCRE NGLKPGDSVT
FKLESSNTKT PLLLFSIAES KSASTKDRTR FLTLTVTPSS IRSSRLYLSK KFISVNKMER
AGGKKITLLD KNGEEWPVTL LMDKRYTRMV LGSGLREFCN AIGVKAYESV VLELVWEETT
TLPMFKFCSK IKT
Length = 493 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31650

>At4g31650 putative protein
          Length = 493

 Score = 94.6 bits (234), Expect = 6e-20
 Identities = 11/107 (10%), Positives = 30/107 (27%), Gaps = 7/107 (6%)

Query: 85  RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR 144
                 F + +  S++     + +P+  A+ +        G    +   +    W  +  
Sbjct: 126 SSDLTCFSQSVTTSNLMRDS-VGVPRDFAKRY----GFNIGRHEIVLMNEEGKPWESEVI 180

Query: 145 YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
                + ++ V            L++GD         +   V +   
Sbjct: 181 --SYKSGKVIVAGGWKSLCTESKLEVGDSCTFKLLHNAKMPVFRLCS 225



 Score = 77.2 bits (189), Expect = 9e-15
 Identities = 13/78 (16%), Positives = 26/78 (32%), Gaps = 5/78 (6%)

Query: 107 ILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAH 166
            LP+        +    +G    +   +G   WT   ++  +  S  Y       F   +
Sbjct: 297 SLPRNFV----RSDGLIKGSNKIVLMNEGARTWTLILKFRDSRRSF-YSRGGWRSFCREN 351

Query: 167 GLQLGDFIMVYQDLYSNN 184
           GL+ GD +    +  +  
Sbjct: 352 GLKPGDSVTFKLESSNTK 369


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 3.4e-27T[131-230] 1.9e-31T[284-382] 6.3e-33T[391-492] 7.3e-19 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[55-104] 0.0093 Cupredoxins
Cupredoxin
NULL
seg ?[106-121] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 95 6e-20
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 84 2e-16
TF_17_2 ARFNPH4/ARF7 65 3e-10

TOP