AGI ID: At4g31640

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
>At4g31640
MKNPTLFAPK SPHFFQPILP GFKSHIKIPV KFFSKHIEGK HEGNTVYLRS YPSRRTWKVK
MEGHKLTEGW KEFVEAHDLR VGDFVVFKHK GDMLFHVTAI GPSCCEVQYA PSRSHDRNEE
SDEIGESSRN EKIIEENVKT EPDQFSPDLT CFSQSVTASN LTRDLVGIPR DFAKRYGLNI
GRHEIVLMDE EGNTWESEVK SYKSGRVFIA GGWTSLCTAN KLEVGDSCTF KLLRNPKIPV
FRLCSRPKAG AEARPHKRSR VQSSSGGSRQ KHDVRQKLDE EGGPSRCTRS SNKATGDQEK
LQQTQSCFIF DHVAKVKQSV EDTLNSIRRF RAKLETKEHN LEALLQETKT KL
Length = 352 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31640

>At4g31640 putative protein
          Length = 352

 Score =  102 bits (254), Expect = 3e-22
 Identities = 12/108 (11%), Positives = 35/108 (32%), Gaps = 7/108 (6%)

Query: 85  RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR 144
                 F + +  S+++    + +P+  A+ +        G    +   +  + W  + +
Sbjct: 146 SPDLTCFSQSVTASNLTRDL-VGIPRDFAKRY----GLNIGRHEIVLMDEEGNTWESEVK 200

Query: 145 YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKA 192
                + R+++         A+ L++GD             V +    
Sbjct: 201 --SYKSGRVFIAGGWTSLCTANKLEVGDSCTFKLLRNPKIPVFRLCSR 246



 Score = 41.8 bits (97), Expect = 5e-04
 Identities = 19/92 (20%), Positives = 34/92 (36%), Gaps = 13/92 (14%)

Query: 106 MILPK--KAAEAHLPALECKEGIPIRM--EDLDGFHVWTFKYRY-------WPNNNSRMY 154
           +  PK     +  LP  +    IP++   + ++G H     Y         W        
Sbjct: 6   LFAPKSPHFFQPILPGFKSHIKIPVKFFSKHIEGKHEGNTVYLRSYPSRRTWKVKMEGHK 65

Query: 155 VLENTGDFVNAHGLQLGDFIMVYQDLYSNNYV 186
           + E   +FV AH L++GDF++       +   
Sbjct: 66  LTEGWKEFVEAHDLRVGDFVVFK--HKGDMLF 95


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 1.6e-33T[151-250] 3.8e-34 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[45-118] 1.1e-09 Cupredoxins
Cupredoxin
NULL
coil ?[327-352] coiled-coil
seg ?[258-270] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3102 3e-22
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 98 1e-20
TF_17_2 ARFNPH4/ARF7 52 2e-06

TOP