AGI ID: At4g31630

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g31630
MADPLIPSPT NKAFFIIDLS GQKSNPIIPT EFIWNHFNGK IQSTNMKLTS DASDRNWDVK
LDGARFAGGW KDFSVSHSVR DDDLLSFRHD GGMVFHVSPF GRSFSQIQLI SSSTSDDDDD
ERTVFDDDED DDVGDDDDNS ISEDDFCSKK ISSKKRARKE TESSSDKSYL VAHVTPSSLL
RDNMCVLSKF ARSNGLDRRE CEIDLRDEHE KSWTLLLRHN KKTGQAFMRG GWRSFCRNNG
IKAGSICRFK LVQSGIKPVL QLCPNASSIP EGNSSKARKK RNVSEIEGDE IESENCSETI
PLNQNKILTF DLKPYVFRSC QFFLPASFAR ENGIVEAGEV TVLNKDGIEW KSHLVNIKGR
DQFYNRGCQD FFVANGVKNV GDPFTLEVIR GGPSPILKIC SKVKQAASSD GHKTADRKPR
MTDQAPLAEE QTDNRVEKRA QVTEEGGPSR STRADPGNLQ QKQPCSISDH VKKVKQSIVD
TLTDVRRFQS ELKVKEQNLE ASLQEIDALG MI
Length = 512 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31630

>At4g31630 putative protein
          Length = 512

 Score =  100 bits (250), Expect = 8e-22
 Identities = 10/114 (8%), Positives = 27/114 (22%), Gaps = 6/114 (5%)

Query: 80  RKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVW 139
           ++ +    +      +  S +      +L K        +              +    W
Sbjct: 159 KETESSSDKSYLVAHVTPSSLLRDNMCVLSK-----FARSNGLDRRECEIDLRDEHEKSW 213

Query: 140 TFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKAS 193
           T           + ++      F   +G++ G              V+Q    +
Sbjct: 214 TL-LLRHNKKTGQAFMRGGWRSFCRNNGIKAGSICRFKLVQSGIKPVLQLCPNA 266


InterPro Results:

IPR003340 Family
PF02362 T[13-105] 2.2e-20T[169-269] 7.9e-41T[307-406] 1.3e-22 B3
Transcriptional factor B3
NULL
coil ?[485-506] coiled-coil
seg ?[111-145]?[148-155] seg
NULL

Selected Motif:

Link to RARGE contents:

AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3100 8e-22
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 90 3e-18
TF_17_2 ARFNPH4/ARF7 45 2e-04

TOP