AGI ID: At4g31625

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: unknown protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g31625
MANHPLSSSR SNRPFFVRSL AGHTSNLIIP DEFFTAHLEG KTGLTKLKLT SDASDRIWDV
RLNGRRFAGG WDDFSAAHCL RDDDVLVFRL DVKMVFHVTP SGRSFSQIRT SSSSGDYDSD
DDDDEAGDDD SDSKNISLKK KSRFEAESSS SEKYCLLGLT ASNLRLNRVS FTKHFSRANG
LTKRCCMIDL MNLSGESWTL GLRHNKRTGQ AFIRGRWRSF CHANELKPGS FYRFKLVRNG
TRPLLQLCFK VIPQGNCSNS KANGKANVSE KYSREDGSAS TKQNKFLTVT LKHYMIQSGQ
LRLRRSFVRE NGIKEAEEII LVDKNGVEWP SYVSSSKQRR EFYMAHGWIR FCEANKLKTG
ETFTLEFVRG EGTTPMLKFC SEAKIEQEEA PEERGTPLPK RARVSAEVGH SRRTQAPNKS
SDDPKILQRK QPLQPCSFSD QAKKVKQSIV NILTGIKRFR SELELKERNL EAALLEIDAL
GDKVSEINKI LK
Length = 492 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31625

>At4g31625 unknown protein
          Length = 492

 Score = 91.5 bits (226), Expect = 5e-19
 Identities = 14/110 (12%), Positives = 30/110 (26%), Gaps = 6/110 (5%)

Query: 81  KIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWT 140
           + +           L  S++  L R+       +    A    +   +          WT
Sbjct: 145 EAESSSSEKYCLLGLTASNL-RLNRVS----FTKHFSRANGLTKRCCMIDLMNLSGESWT 199

Query: 141 FKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQAR 190
              R       + ++      F +A+ L+ G F            ++Q  
Sbjct: 200 LGLR-HNKRTGQAFIRGRWRSFCHANELKPGSFYRFKLVRNGTRPLLQLC 248



 Score = 51.0 bits (121), Expect = 8e-07
 Identities = 17/116 (14%), Positives = 35/116 (29%), Gaps = 10/116 (8%)

Query: 79  ARKIDPRKLRF--LFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGF 136
           +R+      +        LK+  + S  ++ L +            KE   I + D +G 
Sbjct: 273 SREDGSASTKQNKFLTVTLKHYMIQS-GQLRLRRSFV----RENGIKEAEEIILVDKNG- 326

Query: 137 HVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSN-NYVIQARK 191
             W   Y          Y+      F  A+ L+ G+   +          +++   
Sbjct: 327 VEWPS-YVSSSKQRREFYMAHGWIRFCEANKLKTGETFTLEFVRGEGTTPMLKFCS 381


InterPro Results:

IPR003340 Family
PF02362 T[14-106] 5.7e-23T[154-254] 3.6e-35T[286-386] 7e-29 B3
Transcriptional factor B3
NULL
coil ?[456-484] coiled-coil
seg ?[40-50]?[80-92]?[101-133]?[382-393] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
AC/DS transposon mutant
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 91 5e-19
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 80 4e-15
TF_17_2 ARFNPH4/ARF7 52 2e-06

TOP