AGI ID: At4g31615

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: putative protein

Amino Acid Sequence:


1
61
121
181
241
301
361
421
>At4g31615
MDDPAISSPT NKHFFVIVLH GHKSSPMIPA EFFSTYVEGK NHQSTKLKLT SDAFDRTWEV
KLNGRRFAGG WENFSTVHSL QDDDVVIFRE IGDMTFHVTA SGRSFCKLQY ISSDEDRADE
DDAWNVYSDS KNIVSKKKPR TEAESSSKNY YLVAHVTPSN LSRDRLYLIK AFARSNGLNE
RCCEIDLMNK HGKSWTLGLR YSTVNDQASI SGGWRDFCLV NGLEAGSFYR FKLVQNGERP
LLRLCYDTIP EEDCYKGNRK VNLSESASMK QGKFLTMTFK PYMLKSGQLR LSRPFAIENE
IKEAEDITLV DKNGGNWPSY VASGDGQGGK YYLAKGWRSF CAANRLKTGE TFTLEFVRGE
GTTPMLKFCS KSKDKIEQVP FDEGGETQEE TETRVKKRAR VSAERGSSRR NQASNKPNAD
PQNLQPGQPH CSISDQVQKV KQIIVDTLTG IKRIRSELER KGQKLEASIL EIDALGMI
Length = 478 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31615

>At4g31615 putative protein
          Length = 478

 Score =  103 bits (258), Expect = 1e-22
 Identities = 19/113 (16%), Positives = 34/113 (29%), Gaps = 6/113 (5%)

Query: 78  PARKIDPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFH 137
           P  + +     +     +  S++S   R+ L K  A     +    E             
Sbjct: 139 PRTEAESSSKNYYLVAHVTPSNLSRD-RLYLIKAFA----RSNGLNERCCEIDLMNKHGK 193

Query: 138 VWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQAR 190
            WT   RY   N  +  +     DF   +GL+ G F            +++  
Sbjct: 194 SWTLGLRYSTVN-DQASISGGWRDFCLVNGLEAGSFYRFKLVQNGERPLLRLC 245



 Score = 58.0 bits (139), Expect = 7e-09
 Identities = 15/93 (16%), Positives = 31/93 (33%), Gaps = 6/93 (6%)

Query: 102 SLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGD 161
              ++ L +  A       E KE   I + D +G + W            + Y+ +    
Sbjct: 285 KSGQLRLSRPFAI----ENEIKEAEDITLVDKNGGN-WPSYVASGDGQGGKYYLAKGWRS 339

Query: 162 FVNAHGLQLGDFIMVYQDLYSN-NYVIQARKAS 193
           F  A+ L+ G+   +          +++    S
Sbjct: 340 FCAANRLKTGETFTLEFVRGEGTTPMLKFCSKS 372


InterPro Results:

IPR003340 Family
PF02362 T[13-106] 2.8e-26T[151-251] 4.1e-41T[274-375] 1.7e-34 B3
Transcriptional factor B3
NULL
seg ?[112-123]?[383-393] seg
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3103 1e-22
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 81 2e-15
TF_17_2 ARFNPH4/ARF7 50 1e-05

TOP