AGI ID: At4g31610

TF ID:TF_22_1
Super family:ABI3/VP1
Sub family:FUSCA3
Gene name: reproductive meristem protein 1 (REM1)

Amino Acid Sequence:


1
61
121
181
241
301
361
421
481
>At4g31610
MADPPHFSLF QQKFRTGDKP FLTLDADFLM NHTKVLLKSD ASDKVWKVKL DGGRLSEGWE
EFACDQKFRD GDVLVFKHHG DEVFHVAVVS PSVSGDIRNA SSSQVITEDT YIDVDDVDDD
DYGQDDEDDD DDDDEGEDNI ENISEKTDKR QEADSSSDHS GFITARVTRY SLLHDRLDLS
RNFTLLFGGH QKTCEIDVVD EQGRRWTMKL AKNISSGVFY IRLGWGNFCC ANGLTQGDLC
KFKLFQNEER PVLWLCPQES GNGRKEKRTF DEVSKGKEKK TPSPFLIVKY TPSRETTGQL
SLPVSFTRNN SINKTGEVIL LNQDGRKWSS YLQITGLGRG AGSEWFYLRR GWREMCEANG
VGVNDSFKLE LVWEGANPMF KFCSKIENHE YKGKGNQRTR KKRACETAPQ PRNVKKTPRL
GVEGPVYQVD EERGHTQVSN RTNTISGNLQ RLLPPSCSVS DQVANVKQGI VDSLNTVRQC
RTELETSEQN LQASLLAIDA LGERIWGISK ILSSNLV
Length = 517 AA.

PSI BLAST Result:

Query: Query sequence of TF_22_1
Sbjct: At4g31610

>At4g31610 reproductive meristem protein 1 (REM1)
          Length = 517

 Score = 81.1 bits (199), Expect = 7e-16
 Identities = 19/113 (16%), Positives = 34/113 (29%), Gaps = 7/113 (6%)

Query: 80  RKIDPRKLRFLF-QKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHV 138
           ++ D       F    +    +    R+ L +            ++   I + D  G   
Sbjct: 151 QEADSSSDHSGFITARVTRYSLLHD-RLDLSRNFTLLF---GGHQKTCEIDVVDEQG-RR 205

Query: 139 WTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
           WT K      ++   Y+    G+F  A+GL  GD             V+    
Sbjct: 206 WTMKLAK-NISSGVFYIRLGWGNFCCANGLTQGDLCKFKLFQNEERPVLWLCP 257



 Score = 50.6 bits (120), Expect = 1e-06
 Identities = 9/113 (7%), Positives = 28/113 (23%), Gaps = 10/113 (8%)

Query: 83  DPRKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFK 142
           + +        +   S  ++  ++ LP                    +        W+  
Sbjct: 278 EKKTPSPFLIVKYTPSRETT-GQLSLPVS-----FTRNNSINKTGEVILLNQDGRKWSSY 331

Query: 143 YRY----WPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARK 191
            +         +   Y+     +   A+G+ + D   +       N + +   
Sbjct: 332 LQITGLGRGAGSEWFYLRRGWREMCEANGVGVNDSFKLELVWEGANPMFKFCS 384


InterPro Results:

IPR003340 Family
PF02362 T[9-94] 3.5e-17T[162-262] 1.4e-35T[285-389] 1.3e-34 B3
Transcriptional factor B3
IPR008972 Domain
SSF49503 T[44-86] 0.00038 Cupredoxins
Cupredoxin
NULL
seg ?[106-138] seg
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_22_1 ABI3/VP1FUSCA3 81 7e-16
TF_22_2 ABI3/VP1ABSCISIC ACID-INSENSITIVE3 78 1e-14
TF_17_2 ARFNPH4/ARF7 47 5e-05

TOP